Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 92572..92871 | Replicon | chromosome |
Accession | NZ_CP113042 | ||
Organism | Staphylococcus aureus strain Seraphine |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | OS079_RS00505 | Protein ID | WP_011447039.1 |
Coordinates | 92695..92871 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 92572..92627 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS079_RS00465 | 87903..88163 | + | 261 | WP_001791826.1 | hypothetical protein | - |
OS079_RS00470 | 88216..88566 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
OS079_RS00475 | 89251..89700 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
OS079_RS00480 | 89795..90130 | - | 336 | Protein_90 | SH3 domain-containing protein | - |
OS079_RS00485 | 90780..91271 | - | 492 | WP_267837936.1 | staphylokinase | - |
OS079_RS00490 | 91462..92217 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
OS079_RS00495 | 92229..92483 | - | 255 | WP_000611512.1 | phage holin | - |
OS079_RS00500 | 92535..92642 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 92564..92703 | + | 140 | NuclAT_0 | - | - |
- | 92564..92703 | + | 140 | NuclAT_0 | - | - |
- | 92564..92703 | + | 140 | NuclAT_0 | - | - |
- | 92564..92703 | + | 140 | NuclAT_0 | - | - |
- | 92572..92627 | + | 56 | - | - | Antitoxin |
OS079_RS00505 | 92695..92871 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
OS079_RS00510 | 93021..93317 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
OS079_RS00515 | 93375..93662 | - | 288 | WP_001040261.1 | hypothetical protein | - |
OS079_RS00520 | 93709..93861 | - | 153 | WP_001153681.1 | hypothetical protein | - |
OS079_RS00525 | 93851..97636 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 88216..144164 | 55948 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T265271 WP_011447039.1 NZ_CP113042:c92871-92695 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT265271 NZ_CP113042:92572-92627 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|