265268

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2732935..2733349 Replicon chromosome
Accession NZ_CP113039
Organism Staphylococcus aureus strain Gwen

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag OS086_RS13665 Protein ID WP_031267622.1
Coordinates 2733098..2733349 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OS086_RS13660 Protein ID WP_000028424.1
Coordinates 2732935..2733108 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS086_RS13620 (2728199) 2728199..2728489 - 291 WP_000665205.1 VRR-NUC domain-containing protein -
OS086_RS13625 (2728623) 2728623..2728721 + 99 WP_001801650.1 hypothetical protein -
OS086_RS13630 (2728830) 2728830..2731277 - 2448 WP_000884870.1 VapE family protein -
OS086_RS13635 (2731565) 2731565..2731765 - 201 WP_000265252.1 DUF1514 family protein -
OS086_RS13640 (2731833) 2731833..2731985 - 153 WP_000595263.1 transcriptional activator RinB -
OS086_RS13645 (2731982) 2731982..2732188 - 207 WP_000195810.1 DUF1381 domain-containing protein -
OS086_RS13650 (2732225) 2732225..2732758 - 534 WP_063653166.1 dUTPase -
OS086_RS13655 (2732773) 2732773..2732934 - 162 WP_000889684.1 hypothetical protein -
OS086_RS13660 (2732935) 2732935..2733108 - 174 WP_000028424.1 hypothetical protein Antitoxin
OS086_RS13665 (2733098) 2733098..2733349 - 252 WP_031267622.1 DUF1024 family protein Toxin
OS086_RS13670 (2733342) 2733342..2733649 - 308 Protein_2657 hypothetical protein -
OS086_RS13675 (2733646) 2733646..2733993 - 348 WP_000979209.1 YopX family protein -
OS086_RS13680 (2733990) 2733990..2734370 - 381 WP_001668982.1 hypothetical protein -
OS086_RS13685 (2734373) 2734373..2734579 - 207 WP_000693989.1 hypothetical protein -
OS086_RS13690 (2734593) 2734593..2734841 - 249 WP_060474161.1 SAV1978 family virulence-associated passenger protein -
OS086_RS13695 (2734841) 2734841..2735095 - 255 WP_000022722.1 DUF3310 domain-containing protein -
OS086_RS13700 (2735092) 2735092..2735496 - 405 WP_044426014.1 SA1788 family PVL leukocidin-associated protein -
OS086_RS13705 (2735496) 2735496..2735681 - 186 WP_001164629.1 DUF3113 family protein -
OS086_RS13710 (2735694) 2735694..2737646 - 1953 WP_078064460.1 DNA polymerase -
OS086_RS13715 (2737714) 2737714..2738271 - 558 WP_000645045.1 DUF2815 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2701279..2759873 58594


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9419.35 Da        Isoelectric Point: 3.9476

>T265268 WP_031267622.1 NZ_CP113039:c2733349-2733098 [Staphylococcus aureus]
MNNREKIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGIELDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT265268 WP_000028424.1 NZ_CP113039:c2733108-2732935 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References