Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2341607..2342021 Replicon chromosome
Accession NZ_CP113037
Organism Staphylococcus aureus strain Zilean

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag OS091_RS11885 Protein ID WP_001065064.1
Coordinates 2341770..2342021 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OS091_RS11880 Protein ID WP_000028424.1
Coordinates 2341607..2341780 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS091_RS11845 2338022..2339246 - 1225 Protein_2233 PBSX family phage terminase large subunit -
OS091_RS11850 2339239..2339700 - 462 WP_001794914.1 hypothetical protein -
OS091_RS11855 2340088..2340489 - 402 WP_000286968.1 hypothetical protein -
OS091_RS11860 2340490..2340663 - 174 WP_149569684.1 transcriptional activator RinB -
OS091_RS11865 2340660..2340866 - 207 WP_029625633.1 DUF1381 domain-containing protein -
OS091_RS11870 2340903..2341430 - 528 WP_149569683.1 dUTPase -
OS091_RS11875 2341445..2341606 - 162 WP_000889680.1 hypothetical protein -
OS091_RS11880 2341607..2341780 - 174 WP_000028424.1 hypothetical protein Antitoxin
OS091_RS11885 2341770..2342021 - 252 WP_001065064.1 DUF1024 family protein Toxin
OS091_RS11890 2342036..2342284 - 249 WP_001126846.1 phi PVL orf 51-like protein -
OS091_RS11895 2342285..2342656 - 372 WP_001140289.1 SA1788 family PVL leukocidin-associated protein -
OS091_RS11900 2342657..2342842 - 186 WP_001187242.1 DUF3113 family protein -
OS091_RS11905 2342847..2343251 - 405 WP_000049784.1 DUF1064 domain-containing protein -
OS091_RS11910 2343262..2343483 - 222 WP_001123673.1 DUF3269 family protein -
OS091_RS11915 2343496..2343657 - 162 WP_000237153.1 hypothetical protein -
OS091_RS11920 2343651..2344425 - 775 Protein_2248 ATP-binding protein -
OS091_RS11925 2344435..2345205 - 771 WP_031769013.1 conserved phage C-terminal domain-containing protein -
OS091_RS11930 2345270..2346127 + 858 WP_000371250.1 DUF4393 domain-containing protein -
OS091_RS11935 2346233..2346907 - 675 WP_031769015.1 putative HNHc nuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2313378..2357068 43690


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9377.26 Da        Isoelectric Point: 3.7128

>T265251 WP_001065064.1 NZ_CP113037:c2342021-2341770 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT265251 WP_000028424.1 NZ_CP113037:c2341780-2341607 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References