Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1640652..1641066 Replicon chromosome
Accession NZ_CP113037
Organism Staphylococcus aureus strain Zilean

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag OS091_RS08540 Protein ID WP_001065099.1
Coordinates 1640652..1640903 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OS091_RS08545 Protein ID WP_000028424.1
Coordinates 1640893..1641066 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS091_RS08480 1635870..1636313 + 444 WP_001099007.1 single-stranded DNA-binding protein -
OS091_RS08485 1636325..1636999 + 675 WP_000057262.1 putative HNHc nuclease -
OS091_RS08490 1636996..1637145 + 150 WP_001081076.1 hypothetical protein -
OS091_RS08495 1637138..1637419 - 282 WP_000414755.1 hypothetical protein -
OS091_RS08500 1637485..1638255 + 771 WP_000190254.1 conserved phage C-terminal domain-containing protein -
OS091_RS08505 1638265..1639044 + 780 WP_000803062.1 ATP-binding protein -
OS091_RS08510 1639038..1639196 + 159 WP_000256594.1 hypothetical protein -
OS091_RS08515 1639209..1639430 + 222 WP_001123669.1 DUF3269 family protein -
OS091_RS08520 1639440..1639844 + 405 WP_000049798.1 DUF1064 domain-containing protein -
OS091_RS08525 1639849..1640034 + 186 WP_001187236.1 DUF3113 family protein -
OS091_RS08530 1640035..1640391 + 357 WP_000029366.1 SA1788 family PVL leukocidin-associated protein -
OS091_RS08535 1640395..1640637 + 243 WP_000131388.1 phi PVL orf 51-like protein -
OS091_RS08540 1640652..1640903 + 252 WP_001065099.1 DUF1024 family protein Toxin
OS091_RS08545 1640893..1641066 + 174 WP_000028424.1 hypothetical protein Antitoxin
OS091_RS08550 1641067..1641348 + 282 WP_000454994.1 hypothetical protein -
OS091_RS08555 1641349..1641510 + 162 WP_000889683.1 hypothetical protein -
OS091_RS08560 1641525..1642031 + 507 WP_001061834.1 dUTPase -
OS091_RS08565 1642068..1642313 + 246 WP_001282074.1 hypothetical protein -
OS091_RS08570 1642310..1642498 + 189 WP_000195782.1 DUF1381 domain-containing protein -
OS091_RS08575 1642473..1642673 + 201 WP_001125015.1 hypothetical protein -
OS091_RS08580 1642676..1642825 + 150 WP_000237868.1 transcriptional activator RinB -
OS091_RS08585 1642984..1643634 + 651 WP_001005262.1 hypothetical protein -
OS091_RS08590 1643634..1643834 + 201 WP_000265043.1 DUF1514 family protein -
OS091_RS08595 1643862..1644278 + 417 WP_000590122.1 hypothetical protein -
OS091_RS08600 1644510..1644809 + 300 WP_000988330.1 HNH endonuclease -
OS091_RS08605 1644940..1645284 + 345 WP_000402904.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9376.32 Da        Isoelectric Point: 3.8364

>T265250 WP_001065099.1 NZ_CP113037:1640652-1640903 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILKGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT265250 WP_000028424.1 NZ_CP113037:1640893-1641066 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References