Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 1030174..1030437 | Replicon | chromosome |
Accession | NZ_CP113037 | ||
Organism | Staphylococcus aureus strain Zilean |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | OS091_RS05255 | Protein ID | WP_001802298.1 |
Coordinates | 1030174..1030278 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 1030273..1030437 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS091_RS05225 | 1025568..1026350 | + | 783 | WP_000908190.1 | ABC transporter ATP-binding protein | - |
OS091_RS05230 | 1026418..1027275 | + | 858 | WP_000370919.1 | HAD family hydrolase | - |
OS091_RS05235 | 1027469..1027683 | - | 215 | Protein_960 | exotoxin | - |
OS091_RS05240 | 1027970..1028062 | - | 93 | WP_031844941.1 | hypothetical protein | - |
OS091_RS05245 | 1028351..1029487 | + | 1137 | Protein_962 | SAP domain-containing protein | - |
OS091_RS05250 | 1029530..1030013 | + | 484 | Protein_963 | recombinase family protein | - |
OS091_RS05255 | 1030174..1030278 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 1030273..1030437 | - | 165 | - | - | Antitoxin |
OS091_RS05265 | 1030727..1031818 | - | 1092 | WP_267842140.1 | transcriptional regulator | - |
OS091_RS05270 | 1032084..1033061 | - | 978 | WP_000019732.1 | CDF family zinc efflux transporter CzrB | - |
OS091_RS05275 | 1033063..1033383 | - | 321 | WP_000139802.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
OS091_RS05280 | 1033535..1034200 | + | 666 | WP_001024088.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T265244 WP_001802298.1 NZ_CP113037:1030174-1030278 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT265244 NZ_CP113037:c1030437-1030273 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|