Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 743656..743840 | Replicon | chromosome |
Accession | NZ_CP113037 | ||
Organism | Staphylococcus aureus strain Zilean |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | OS091_RS03770 | Protein ID | WP_000482647.1 |
Coordinates | 743656..743763 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 743780..743840 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS091_RS03745 | 739018..739491 | + | 474 | WP_000456483.1 | GyrI-like domain-containing protein | - |
OS091_RS03750 | 739614..740825 | - | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
OS091_RS03755 | 741008..741667 | - | 660 | WP_000831298.1 | membrane protein | - |
OS091_RS03760 | 741727..742869 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
OS091_RS03765 | 743137..743523 | + | 387 | WP_000779353.1 | flippase GtxA | - |
OS091_RS03770 | 743656..743763 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 743780..743840 | - | 61 | - | - | Antitoxin |
OS091_RS03775 | 744411..746123 | + | 1713 | WP_001064821.1 | ABC transporter ATP-binding protein | - |
OS091_RS03780 | 746199..747932 | + | 1734 | WP_000488493.1 | ABC transporter ATP-binding protein | - |
OS091_RS03785 | 748163..748330 | + | 168 | WP_031845053.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T265242 WP_000482647.1 NZ_CP113037:743656-743763 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT265242 NZ_CP113037:c743840-743780 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|