Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2316582..2316845 | Replicon | chromosome |
Accession | NZ_CP113032 | ||
Organism | Staphylococcus aureus strain Akali |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | OS080_RS12110 | Protein ID | WP_001802298.1 |
Coordinates | 2316741..2316845 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2316582..2316746 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS080_RS12085 | 2312765..2313430 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
OS080_RS12090 | 2313582..2313902 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
OS080_RS12095 | 2313904..2314884 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
OS080_RS12100 | 2315150..2316241 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2316582..2316746 | + | 165 | - | - | Antitoxin |
OS080_RS12110 | 2316741..2316845 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
OS080_RS12115 | 2317006..2317489 | - | 484 | Protein_2325 | recombinase family protein | - |
OS080_RS12120 | 2317532..2318668 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
OS080_RS12125 | 2318957..2319049 | + | 93 | WP_001790138.1 | hypothetical protein | - |
OS080_RS12130 | 2319338..2319522 | + | 185 | Protein_2328 | exotoxin | - |
OS080_RS12135 | 2319754..2320611 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
OS080_RS12140 | 2320679..2321461 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T265236 WP_001802298.1 NZ_CP113032:c2316845-2316741 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT265236 NZ_CP113032:2316582-2316746 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|