Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2069624..2069923 | Replicon | chromosome |
Accession | NZ_CP113032 | ||
Organism | Staphylococcus aureus strain Akali |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
Locus tag | OS080_RS10570 | Protein ID | WP_072482930.1 |
Coordinates | 2069747..2069923 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2069624..2069679 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS080_RS10530 | 2065182..2065361 | + | 180 | WP_000669789.1 | hypothetical protein | - |
OS080_RS10535 | 2065672..2065932 | + | 261 | WP_001791826.1 | hypothetical protein | - |
OS080_RS10540 | 2065985..2066335 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
OS080_RS10545 | 2066845..2067180 | - | 336 | Protein_2016 | SH3 domain-containing protein | - |
OS080_RS10550 | 2067832..2068323 | - | 492 | WP_000920041.1 | staphylokinase | - |
OS080_RS10555 | 2068514..2069269 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
OS080_RS10560 | 2069281..2069535 | - | 255 | WP_000611512.1 | phage holin | - |
OS080_RS10565 | 2069587..2069694 | + | 108 | Protein_2020 | hypothetical protein | - |
- | 2069616..2069755 | + | 140 | NuclAT_0 | - | - |
- | 2069616..2069755 | + | 140 | NuclAT_0 | - | - |
- | 2069616..2069755 | + | 140 | NuclAT_0 | - | - |
- | 2069616..2069755 | + | 140 | NuclAT_0 | - | - |
- | 2069624..2069679 | + | 56 | - | - | Antitoxin |
OS080_RS10570 | 2069747..2069923 | - | 177 | WP_072482930.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
OS080_RS10575 | 2070032..2070805 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
OS080_RS10580 | 2071178..2071552 | - | 375 | WP_000340977.1 | hypothetical protein | - |
OS080_RS10585 | 2071608..2071895 | - | 288 | WP_001262621.1 | hypothetical protein | - |
OS080_RS10590 | 2071941..2072093 | - | 153 | WP_001000059.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2065985..2123511 | 57526 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T265229 WP_072482930.1 NZ_CP113032:c2069923-2069747 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT265229 NZ_CP113032:2069624-2069679 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|