Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1909595..1909777 | Replicon | chromosome |
Accession | NZ_CP113032 | ||
Organism | Staphylococcus aureus strain Akali |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | OS080_RS09585 | Protein ID | WP_001801861.1 |
Coordinates | 1909595..1909690 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1909718..1909777 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS080_RS09545 | 1905255..1905881 | + | 627 | WP_000669046.1 | hypothetical protein | - |
OS080_RS09550 | 1905922..1906266 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
OS080_RS09555 | 1906364..1906915 | + | 552 | WP_267793679.1 | hypothetical protein | - |
OS080_RS09560 | 1907133..1907774 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
OS080_RS09565 | 1907888..1908073 | - | 186 | WP_000809857.1 | hypothetical protein | - |
OS080_RS09570 | 1908075..1908251 | - | 177 | WP_000375476.1 | hypothetical protein | - |
OS080_RS09575 | 1908262..1908645 | - | 384 | WP_000070811.1 | hypothetical protein | - |
OS080_RS09580 | 1909249..1909392 | - | 144 | WP_001549059.1 | transposase | - |
OS080_RS09585 | 1909595..1909690 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1909718..1909777 | - | 60 | - | - | Antitoxin |
OS080_RS09590 | 1909813..1909914 | + | 102 | WP_001791893.1 | hypothetical protein | - |
OS080_RS09595 | 1909892..1910068 | - | 177 | Protein_1866 | transposase | - |
OS080_RS09600 | 1910262..1910639 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1902695..1927949 | 25254 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T265227 WP_001801861.1 NZ_CP113032:1909595-1909690 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT265227 NZ_CP113032:c1909777-1909718 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|