Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1460904..1461086 | Replicon | chromosome |
| Accession | NZ_CP113029 | ||
| Organism | Staphylococcus aureus strain Zoe | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | OS075_RS07645 | Protein ID | WP_001801861.1 |
| Coordinates | 1460991..1461086 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1460904..1460963 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS075_RS07630 | 1460042..1460419 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| OS075_RS07635 | 1460613..1460789 | + | 177 | Protein_1433 | transposase | - |
| OS075_RS07640 | 1460767..1460868 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 1460904..1460963 | + | 60 | - | - | Antitoxin |
| OS075_RS07645 | 1460991..1461086 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| OS075_RS07650 | 1461289..1461432 | + | 144 | WP_001549059.1 | transposase | - |
| OS075_RS07655 | 1462036..1462419 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| OS075_RS07660 | 1462430..1462606 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| OS075_RS07665 | 1462608..1462793 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| OS075_RS07670 | 1462907..1463548 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| OS075_RS07675 | 1463766..1464317 | - | 552 | WP_000414205.1 | hypothetical protein | - |
| OS075_RS07680 | 1464415..1464759 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| OS075_RS07685 | 1464800..1465426 | - | 627 | Protein_1443 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T265221 WP_001801861.1 NZ_CP113029:c1461086-1460991 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT265221 NZ_CP113029:1460904-1460963 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|