Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 1299798..1300136 | Replicon | chromosome |
| Accession | NZ_CP113029 | ||
| Organism | Staphylococcus aureus strain Zoe | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | OS075_RS06665 | Protein ID | WP_011447039.1 |
| Coordinates | 1299798..1299974 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 1299962..1300136 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS075_RS06645 | 1295033..1298818 | + | 3786 | WP_000582165.1 | phage tail spike protein | - |
| OS075_RS06650 | 1298808..1298960 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| OS075_RS06655 | 1299007..1299294 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| OS075_RS06660 | 1299352..1299648 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| OS075_RS06665 | 1299798..1299974 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - | 1299962..1300136 | - | 175 | - | - | Antitoxin |
| OS075_RS06675 | 1300186..1300440 | + | 255 | WP_000611512.1 | phage holin | - |
| OS075_RS06680 | 1300452..1301207 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| OS075_RS06685 | 1301398..1301889 | + | 492 | WP_000919350.1 | staphylokinase | - |
| OS075_RS06690 | 1302539..1302874 | + | 336 | Protein_1283 | SH3 domain-containing protein | - |
| OS075_RS06695 | 1302969..1303418 | - | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| OS075_RS06700 | 1304103..1304453 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| OS075_RS06705 | 1304506..1304766 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | groEL / hlb / sak / chp / scn | 1248505..1304453 | 55948 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T265217 WP_011447039.1 NZ_CP113029:1299798-1299974 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT265217 NZ_CP113029:c1300136-1299962 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|