Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 1125212..1125475 | Replicon | chromosome |
| Accession | NZ_CP113029 | ||
| Organism | Staphylococcus aureus strain Zoe | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | OS075_RS05670 | Protein ID | WP_001802298.1 |
| Coordinates | 1125212..1125316 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 1125311..1125475 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS075_RS05640 (1120596) | 1120596..1121378 | + | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
| OS075_RS05645 (1121446) | 1121446..1122303 | + | 858 | WP_000370924.1 | HAD family hydrolase | - |
| OS075_RS05650 (1122535) | 1122535..1122719 | - | 185 | Protein_1080 | exotoxin | - |
| OS075_RS05655 (1123008) | 1123008..1123100 | - | 93 | WP_001790138.1 | hypothetical protein | - |
| OS075_RS05660 (1123389) | 1123389..1124525 | + | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| OS075_RS05665 (1124568) | 1124568..1125051 | + | 484 | Protein_1083 | recombinase family protein | - |
| OS075_RS05670 (1125212) | 1125212..1125316 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| - | 1125311..1125475 | - | 165 | - | - | Antitoxin |
| OS075_RS05680 (1125816) | 1125816..1126907 | - | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| OS075_RS05685 (1127173) | 1127173..1128153 | - | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| OS075_RS05690 (1128155) | 1128155..1128475 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| OS075_RS05695 (1128627) | 1128627..1129292 | + | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T265212 WP_001802298.1 NZ_CP113029:1125212-1125316 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT265212 NZ_CP113029:c1125475-1125311 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|