Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 835189..835373 | Replicon | chromosome |
| Accession | NZ_CP113029 | ||
| Organism | Staphylococcus aureus strain Zoe | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | Q2FVI9 |
| Locus tag | OS075_RS04145 | Protein ID | WP_000482650.1 |
| Coordinates | 835189..835296 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 835313..835373 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS075_RS04120 | 830551..831024 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
| OS075_RS04125 | 831147..832358 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| OS075_RS04130 | 832540..833199 | - | 660 | WP_000831298.1 | membrane protein | - |
| OS075_RS04135 | 833259..834401 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
| OS075_RS04140 | 834669..835055 | + | 387 | WP_000779358.1 | flippase GtxA | - |
| OS075_RS04145 | 835189..835296 | + | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 835313..835373 | - | 61 | - | - | Antitoxin |
| OS075_RS04150 | 835924..837687 | + | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein | - |
| OS075_RS04155 | 837712..839445 | + | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein | - |
| OS075_RS04160 | 839676..839843 | + | 168 | WP_001790576.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T265210 WP_000482650.1 NZ_CP113029:835189-835296 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT265210 NZ_CP113029:c835373-835313 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|