Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-MW1433/- |
| Location | 1557021..1557328 | Replicon | chromosome |
| Accession | NZ_CP113027 | ||
| Organism | Staphylococcus aureus strain Syndra | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | OS083_RS08395 | Protein ID | WP_011447039.1 |
| Coordinates | 1557021..1557197 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | MW1433 | ||
| Locus tag | - | ||
| Coordinates | 1557189..1557328 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS083_RS08375 (1554708) | 1554708..1554860 | + | 153 | WP_000654329.1 | hypothetical protein | - |
| OS083_RS08380 (1554907) | 1554907..1555194 | + | 288 | WP_001040255.1 | hypothetical protein | - |
| OS083_RS08385 (1555250) | 1555250..1555624 | + | 375 | WP_000340977.1 | hypothetical protein | - |
| OS083_RS08390 (1556045) | 1556045..1556818 | + | 774 | WP_025174055.1 | staphylococcal enterotoxin type P | - |
| OS083_RS08395 (1557021) | 1557021..1557197 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (1557189) | 1557189..1557328 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (1557189) | 1557189..1557328 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (1557189) | 1557189..1557328 | - | 140 | NuclAT_0 | - | Antitoxin |
| - (1557189) | 1557189..1557328 | - | 140 | NuclAT_0 | - | Antitoxin |
| OS083_RS08400 (1557250) | 1557250..1557357 | - | 108 | WP_031762631.1 | hypothetical protein | - |
| OS083_RS08405 (1557409) | 1557409..1557663 | + | 255 | WP_000611512.1 | phage holin | - |
| OS083_RS08410 (1557675) | 1557675..1558430 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| OS083_RS08415 (1558621) | 1558621..1559112 | + | 492 | WP_000920038.1 | staphylokinase | - |
| OS083_RS08420 (1559763) | 1559763..1560098 | + | 336 | Protein_1539 | SH3 domain-containing protein | - |
| OS083_RS08425 (1560609) | 1560609..1560959 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| OS083_RS08430 (1561012) | 1561012..1561272 | - | 261 | WP_001791826.1 | hypothetical protein | - |
| OS083_RS08435 (1561583) | 1561583..1561762 | - | 180 | WP_000669791.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | see / sak / scn | 1470412..1563829 | 93417 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T265206 WP_011447039.1 NZ_CP113027:1557021-1557197 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT265206 NZ_CP113027:c1557328-1557189 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
