Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 1557021..1557359 | Replicon | chromosome |
Accession | NZ_CP113027 | ||
Organism | Staphylococcus aureus strain Syndra |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | OS083_RS08395 | Protein ID | WP_011447039.1 |
Coordinates | 1557021..1557197 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 1557185..1557359 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS083_RS08375 | 1554708..1554860 | + | 153 | WP_000654329.1 | hypothetical protein | - |
OS083_RS08380 | 1554907..1555194 | + | 288 | WP_001040255.1 | hypothetical protein | - |
OS083_RS08385 | 1555250..1555624 | + | 375 | WP_000340977.1 | hypothetical protein | - |
OS083_RS08390 | 1556045..1556818 | + | 774 | WP_025174055.1 | staphylococcal enterotoxin type P | - |
OS083_RS08395 | 1557021..1557197 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- | 1557185..1557359 | - | 175 | - | - | Antitoxin |
OS083_RS08405 | 1557409..1557663 | + | 255 | WP_000611512.1 | phage holin | - |
OS083_RS08410 | 1557675..1558430 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
OS083_RS08415 | 1558621..1559112 | + | 492 | WP_000920038.1 | staphylokinase | - |
OS083_RS08420 | 1559763..1560098 | + | 336 | Protein_1539 | SH3 domain-containing protein | - |
OS083_RS08425 | 1560609..1560959 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
OS083_RS08430 | 1561012..1561272 | - | 261 | WP_001791826.1 | hypothetical protein | - |
OS083_RS08435 | 1561583..1561762 | - | 180 | WP_000669791.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | see / sak / scn | 1470412..1563829 | 93417 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T265204 WP_011447039.1 NZ_CP113027:1557021-1557197 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT265204 NZ_CP113027:c1557359-1557185 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|