265203

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1484695..1485109 Replicon chromosome
Accession NZ_CP113027
Organism Staphylococcus aureus strain Syndra

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag OS083_RS07880 Protein ID WP_001065099.1
Coordinates 1484695..1484946 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OS083_RS07885 Protein ID WP_000028424.1
Coordinates 1484936..1485109 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS083_RS07830 (1480181) 1480181..1481038 - 858 WP_000371250.1 DUF4393 domain-containing protein -
OS083_RS07835 (1481103) 1481103..1481873 + 771 WP_000190224.1 conserved phage C-terminal domain-containing protein -
OS083_RS07840 (1481883) 1481883..1482662 + 780 WP_103143576.1 ATP-binding protein -
OS083_RS07845 (1482656) 1482656..1482817 + 162 WP_000237153.1 hypothetical protein -
OS083_RS07850 (1482830) 1482830..1483051 + 222 WP_001123688.1 DUF3269 family protein -
OS083_RS07855 (1483061) 1483061..1483486 + 426 WP_000451862.1 DNA N-6-adenine-methyltransferase -
OS083_RS07860 (1483483) 1483483..1483887 + 405 WP_021758092.1 DUF1064 domain-containing protein -
OS083_RS07865 (1483892) 1483892..1484077 + 186 WP_001187236.1 DUF3113 family protein -
OS083_RS07870 (1484078) 1484078..1484434 + 357 WP_000029366.1 SA1788 family PVL leukocidin-associated protein -
OS083_RS07875 (1484438) 1484438..1484680 + 243 WP_000131388.1 phi PVL orf 51-like protein -
OS083_RS07880 (1484695) 1484695..1484946 + 252 WP_001065099.1 DUF1024 family protein Toxin
OS083_RS07885 (1484936) 1484936..1485109 + 174 WP_000028424.1 hypothetical protein Antitoxin
OS083_RS07890 (1485110) 1485110..1485391 + 282 WP_000454994.1 hypothetical protein -
OS083_RS07895 (1485392) 1485392..1485553 + 162 WP_000889683.1 hypothetical protein -
OS083_RS07900 (1485568) 1485568..1486074 + 507 WP_001061834.1 dUTPase -
OS083_RS07905 (1486111) 1486111..1486357 + 247 Protein_1436 hypothetical protein -
OS083_RS07910 (1486354) 1486354..1486506 + 153 WP_038412600.1 DUF1381 domain-containing protein -
OS083_RS07915 (1486499) 1486499..1486957 + 459 WP_001129214.1 hypothetical protein -
OS083_RS07920 (1486970) 1486970..1487143 + 174 WP_000595257.1 transcriptional activator RinB -
OS083_RS07925 (1487144) 1487144..1487545 + 402 WP_000286968.1 hypothetical protein -
OS083_RS07930 (1487900) 1487900..1488394 + 495 WP_000594088.1 terminase small subunit -
OS083_RS07935 (1488387) 1488387..1489610 + 1224 WP_001037578.1 PBSX family phage terminase large subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - see / sak / scn 1470412..1563829 93417


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9376.32 Da        Isoelectric Point: 3.8364

>T265203 WP_001065099.1 NZ_CP113027:1484695-1484946 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILKGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT265203 WP_000028424.1 NZ_CP113027:1484936-1485109 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References