Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 1213760..1214039 | Replicon | chromosome |
| Accession | NZ_CP113027 | ||
| Organism | Staphylococcus aureus strain Syndra | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | OS083_RS06295 | Protein ID | WP_001802298.1 |
| Coordinates | 1213760..1213864 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 1213860..1214039 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS083_RS06265 | 1209154..1209936 | + | 783 | WP_000908190.1 | ABC transporter ATP-binding protein | - |
| OS083_RS06270 | 1210004..1210861 | + | 858 | WP_000370919.1 | HAD family hydrolase | - |
| OS083_RS06275 | 1211055..1211269 | - | 215 | Protein_1154 | exotoxin | - |
| OS083_RS06280 | 1211556..1211648 | - | 93 | WP_031844941.1 | hypothetical protein | - |
| OS083_RS06285 | 1211937..1213073 | + | 1137 | Protein_1156 | SAP domain-containing protein | - |
| OS083_RS06290 | 1213116..1213599 | + | 484 | Protein_1157 | recombinase family protein | - |
| OS083_RS06295 | 1213760..1213864 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| - | 1213860..1214039 | - | 180 | - | - | Antitoxin |
| OS083_RS06305 | 1214313..1215404 | - | 1092 | WP_000495695.1 | hypothetical protein | - |
| OS083_RS06310 | 1215670..1216647 | - | 978 | WP_000019732.1 | CDF family zinc efflux transporter CzrB | - |
| OS083_RS06315 | 1216649..1216969 | - | 321 | WP_000139802.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| OS083_RS06320 | 1217121..1217786 | + | 666 | WP_001024088.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T265197 WP_001802298.1 NZ_CP113027:1213760-1213864 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT265197 NZ_CP113027:c1214039-1213860 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|