Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 881113..881297 | Replicon | chromosome |
| Accession | NZ_CP113027 | ||
| Organism | Staphylococcus aureus strain Syndra | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | OS083_RS04475 | Protein ID | WP_000482647.1 |
| Coordinates | 881113..881220 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 881237..881297 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS083_RS04450 | 876475..876948 | + | 474 | WP_000456483.1 | GyrI-like domain-containing protein | - |
| OS083_RS04455 | 877071..878282 | - | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
| OS083_RS04460 | 878465..879124 | - | 660 | WP_000831298.1 | membrane protein | - |
| OS083_RS04465 | 879184..880326 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
| OS083_RS04470 | 880594..880980 | + | 387 | WP_000779353.1 | flippase GtxA | - |
| OS083_RS04475 | 881113..881220 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 881237..881297 | - | 61 | - | - | Antitoxin |
| OS083_RS04480 | 881868..883580 | + | 1713 | WP_001064821.1 | ABC transporter ATP-binding protein | - |
| OS083_RS04485 | 883656..885389 | + | 1734 | WP_000488493.1 | ABC transporter ATP-binding protein | - |
| OS083_RS04490 | 885620..885787 | + | 168 | WP_031845053.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T265192 WP_000482647.1 NZ_CP113027:881113-881220 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT265192 NZ_CP113027:c881297-881237 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|