Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1430898..1431080 | Replicon | chromosome |
| Accession | NZ_CP113018 | ||
| Organism | Staphylococcus aureus strain Taliyah | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | OS090_RS07665 | Protein ID | WP_001801861.1 |
| Coordinates | 1430985..1431080 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1430898..1430957 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS090_RS07650 | 1430036..1430413 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| OS090_RS07655 | 1430607..1430783 | + | 177 | Protein_1438 | transposase | - |
| OS090_RS07660 | 1430761..1430862 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 1430898..1430957 | + | 60 | - | - | Antitoxin |
| OS090_RS07665 | 1430985..1431080 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| OS090_RS07670 | 1431283..1431426 | + | 144 | WP_001549059.1 | transposase | - |
| OS090_RS07675 | 1432030..1432413 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| OS090_RS07680 | 1432424..1432600 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| OS090_RS07685 | 1432602..1432787 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| OS090_RS07690 | 1432901..1433542 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| OS090_RS07695 | 1433760..1434311 | - | 552 | WP_267793679.1 | hypothetical protein | - |
| OS090_RS07700 | 1434409..1434753 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| OS090_RS07705 | 1434794..1435420 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T265188 WP_001801861.1 NZ_CP113018:c1431080-1430985 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT265188 NZ_CP113018:1430898-1430957 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|