Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) txpA-SprF3/-
Location 1272085..1272392 Replicon chromosome
Accession NZ_CP113018
Organism Staphylococcus aureus strain Taliyah

Toxin (Protein)


Gene name txpA Uniprot ID A0A4U0AGH1
Locus tag OS090_RS06690 Protein ID WP_072482930.1
Coordinates 1272085..1272261 (+) Length 59 a.a.

Antitoxin (RNA)


Gene name SprF3
Locus tag -
Coordinates 1272253..1272392 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS090_RS06670 (1269915) 1269915..1270067 + 153 WP_001000059.1 hypothetical protein -
OS090_RS06675 (1270113) 1270113..1270400 + 288 WP_001262621.1 hypothetical protein -
OS090_RS06680 (1270456) 1270456..1270830 + 375 WP_000340977.1 hypothetical protein -
OS090_RS06685 (1271203) 1271203..1271976 + 774 WP_000750412.1 staphylococcal enterotoxin type A -
OS090_RS06690 (1272085) 1272085..1272261 + 177 WP_072482930.1 type I toxin-antitoxin system toxin PepG1 Toxin
- (1272253) 1272253..1272392 - 140 NuclAT_0 - Antitoxin
- (1272253) 1272253..1272392 - 140 NuclAT_0 - Antitoxin
- (1272253) 1272253..1272392 - 140 NuclAT_0 - Antitoxin
- (1272253) 1272253..1272392 - 140 NuclAT_0 - Antitoxin
OS090_RS06695 (1272314) 1272314..1272421 - 108 Protein_1286 hypothetical protein -
OS090_RS06700 (1272473) 1272473..1272727 + 255 WP_000611512.1 phage holin -
OS090_RS06705 (1272739) 1272739..1273494 + 756 WP_000861038.1 CHAP domain-containing protein -
OS090_RS06710 (1273685) 1273685..1274176 + 492 WP_000920041.1 staphylokinase -
OS090_RS06715 (1274827) 1274827..1275162 + 336 Protein_1290 SH3 domain-containing protein -
OS090_RS06720 (1275672) 1275672..1276022 + 351 WP_000702262.1 complement inhibitor SCIN-A -
OS090_RS06725 (1276075) 1276075..1276335 - 261 WP_267793775.1 hypothetical protein -
OS090_RS06730 (1276646) 1276646..1276825 - 180 WP_000669789.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - groEL / hlb / sea / sak / scn 1218497..1276022 57525


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Small toxic protein BsrE-like

(30-58)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6883.46 Da        Isoelectric Point: 10.6777

>T265186 WP_072482930.1 NZ_CP113018:1272085-1272261 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK

Download         Length: 177 bp

Antitoxin


Download         Length: 140 bp

>AT265186 NZ_CP113018:c1272392-1272253 [Staphylococcus aureus]
ATATATATAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4U0AGH1

Antitoxin

Download structure file

References