Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 1272085..1272423 | Replicon | chromosome |
| Accession | NZ_CP113018 | ||
| Organism | Staphylococcus aureus strain Taliyah | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
| Locus tag | OS090_RS06690 | Protein ID | WP_072482930.1 |
| Coordinates | 1272085..1272261 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 1272249..1272423 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS090_RS06670 | 1269915..1270067 | + | 153 | WP_001000059.1 | hypothetical protein | - |
| OS090_RS06675 | 1270113..1270400 | + | 288 | WP_001262621.1 | hypothetical protein | - |
| OS090_RS06680 | 1270456..1270830 | + | 375 | WP_000340977.1 | hypothetical protein | - |
| OS090_RS06685 | 1271203..1271976 | + | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| OS090_RS06690 | 1272085..1272261 | + | 177 | WP_072482930.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - | 1272249..1272423 | - | 175 | - | - | Antitoxin |
| OS090_RS06700 | 1272473..1272727 | + | 255 | WP_000611512.1 | phage holin | - |
| OS090_RS06705 | 1272739..1273494 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| OS090_RS06710 | 1273685..1274176 | + | 492 | WP_000920041.1 | staphylokinase | - |
| OS090_RS06715 | 1274827..1275162 | + | 336 | Protein_1290 | SH3 domain-containing protein | - |
| OS090_RS06720 | 1275672..1276022 | + | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| OS090_RS06725 | 1276075..1276335 | - | 261 | WP_267793775.1 | hypothetical protein | - |
| OS090_RS06730 | 1276646..1276825 | - | 180 | WP_000669789.1 | hypothetical protein | - |
| OS090_RS06735 | 1277197..1277394 | - | 198 | WP_000239610.1 | phospholipase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | groEL / hlb / sea / sak / scn | 1218497..1276022 | 57525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T265184 WP_072482930.1 NZ_CP113018:1272085-1272261 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT265184 NZ_CP113018:c1272423-1272249 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATATAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATATAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|