Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 1025164..1025443 | Replicon | chromosome |
| Accession | NZ_CP113018 | ||
| Organism | Staphylococcus aureus strain Taliyah | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | OS090_RS05150 | Protein ID | WP_001802298.1 |
| Coordinates | 1025164..1025268 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 1025264..1025443 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS090_RS05120 | 1020548..1021330 | + | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
| OS090_RS05125 | 1021398..1022255 | + | 858 | WP_000370924.1 | HAD family hydrolase | - |
| OS090_RS05130 | 1022487..1022671 | - | 185 | Protein_978 | exotoxin | - |
| OS090_RS05135 | 1022960..1023052 | - | 93 | WP_001790138.1 | hypothetical protein | - |
| OS090_RS05140 | 1023341..1024477 | + | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| OS090_RS05145 | 1024520..1025003 | + | 484 | Protein_981 | recombinase family protein | - |
| OS090_RS05150 | 1025164..1025268 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| - | 1025264..1025443 | - | 180 | - | - | Antitoxin |
| OS090_RS05160 | 1025768..1026859 | - | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| OS090_RS05165 | 1027125..1028105 | - | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| OS090_RS05170 | 1028107..1028427 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| OS090_RS05175 | 1028579..1029244 | + | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T265179 WP_001802298.1 NZ_CP113018:1025164-1025268 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT265179 NZ_CP113018:c1025443-1025264 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|