Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2812732..2812912 | Replicon | chromosome |
Accession | NZ_CP113016 | ||
Organism | Staphylococcus aureus strain Azir |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | OS077_RS14050 | Protein ID | WP_001801861.1 |
Coordinates | 2812732..2812827 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2812855..2812912 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS077_RS14015 | 2807894..2808889 | + | 996 | WP_000070649.1 | DUF4352 domain-containing protein | - |
OS077_RS14020 | 2808963..2809589 | + | 627 | WP_000669028.1 | hypothetical protein | - |
OS077_RS14025 | 2809676..2810183 | + | 508 | Protein_2756 | hypothetical protein | - |
OS077_RS14030 | 2810210..2810962 | + | 753 | WP_000764922.1 | staphylococcal enterotoxin type 27 | - |
OS077_RS14035 | 2811094..2811720 | - | 627 | Protein_2758 | ImmA/IrrE family metallo-endopeptidase | - |
OS077_RS14040 | 2811834..2812280 | - | 447 | WP_000747805.1 | DUF1433 domain-containing protein | - |
OS077_RS14045 | 2812456..2812587 | - | 132 | WP_001808010.1 | hypothetical protein | - |
OS077_RS14050 | 2812732..2812827 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 2812855..2812912 | - | 58 | - | - | Antitoxin |
OS077_RS14055 | 2812950..2813048 | + | 99 | Protein_2762 | hypothetical protein | - |
OS077_RS14060 | 2813478..2814602 | - | 1125 | WP_223876714.1 | hypothetical protein | - |
OS077_RS14065 | 2814664..2815173 | - | 510 | WP_224684909.1 | hypothetical protein | - |
OS077_RS14070 | 2815433..2816605 | + | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
OS077_RS14075 | 2816657..2817097 | - | 441 | Protein_2766 | staphylococcal enterotoxin type U | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | selk | 2811450..2820376 | 8926 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T265173 WP_001801861.1 NZ_CP113016:2812732-2812827 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT265173 NZ_CP113016:c2812912-2812855 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|