Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | TMCS/- |
Location | 1902351..1902930 | Replicon | chromosome |
Accession | NZ_CP113016 | ||
Organism | Staphylococcus aureus strain Azir |
Toxin (Protein)
Gene name | MW1434 | Uniprot ID | A0A4P7P609 |
Locus tag | OS077_RS09570 | Protein ID | WP_001025401.1 |
Coordinates | 1902351..1902596 (+) | Length | 82 a.a. |
Antitoxin (RNA)
Gene name | MW1433 | ||
Locus tag | - | ||
Coordinates | 1902565..1902930 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS077_RS09515 | 1897540..1898460 | - | 921 | WP_000348133.1 | exonuclease domain-containing protein | - |
OS077_RS09520 | 1898476..1899090 | - | 615 | WP_000801423.1 | XRE family transcriptional regulator | - |
OS077_RS09525 | 1899262..1899489 | + | 228 | WP_001030311.1 | hypothetical protein | - |
OS077_RS09530 | 1899515..1899757 | + | 243 | WP_233641832.1 | hypothetical protein | - |
OS077_RS09535 | 1899714..1900214 | - | 501 | WP_094314222.1 | hypothetical protein | - |
OS077_RS09540 | 1900262..1901038 | + | 777 | WP_094314223.1 | phage antirepressor | - |
OS077_RS09545 | 1901054..1901272 | + | 219 | WP_001001383.1 | hypothetical protein | - |
OS077_RS09550 | 1901322..1901519 | + | 198 | WP_094314224.1 | hypothetical protein | - |
OS077_RS09555 | 1901506..1901886 | - | 381 | WP_000773059.1 | DUF2513 domain-containing protein | - |
OS077_RS09560 | 1901953..1902096 | + | 144 | WP_000939498.1 | hypothetical protein | - |
OS077_RS09565 | 1902086..1902295 | - | 210 | WP_000642492.1 | hypothetical protein | - |
OS077_RS09570 | 1902351..1902596 | + | 246 | WP_001025401.1 | DUF2829 domain-containing protein | Toxin |
OS077_RS09575 | 1902565..1902930 | - | 366 | WP_001128433.1 | hypothetical protein | Antitoxin |
OS077_RS09580 | 1902985..1903200 | + | 216 | WP_001097552.1 | hypothetical protein | - |
OS077_RS09585 | 1903227..1903490 | + | 264 | WP_001124196.1 | helix-turn-helix domain-containing protein | - |
OS077_RS09590 | 1903503..1903664 | + | 162 | WP_001285948.1 | DUF1270 domain-containing protein | - |
OS077_RS09595 | 1903758..1904075 | + | 318 | WP_094314225.1 | hypothetical protein | - |
OS077_RS09600 | 1904068..1904370 | + | 303 | WP_000165363.1 | DUF2482 family protein | - |
OS077_RS09605 | 1904375..1904635 | + | 261 | WP_031584888.1 | DUF1108 family protein | - |
OS077_RS09610 | 1904648..1905184 | + | 537 | WP_001004336.1 | host-nuclease inhibitor Gam family protein | - |
OS077_RS09615 | 1905185..1905829 | + | 645 | WP_267836634.1 | ERF family protein | - |
OS077_RS09620 | 1905833..1906258 | + | 426 | WP_094314227.1 | single-stranded DNA-binding protein | - |
OS077_RS09625 | 1906269..1906820 | + | 552 | WP_031927924.1 | NUMOD4 domain-containing protein | - |
OS077_RS09630 | 1906821..1907492 | + | 672 | WP_094314228.1 | putative HNHc nuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1895368..1941328 | 45960 | |
- | inside | Prophage | - | - | 1895368..1948429 | 53061 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 82 a.a. Molecular weight: 9468.72 Da Isoelectric Point: 5.7783
>T265171 WP_001025401.1 NZ_CP113016:1902351-1902596 [Staphylococcus aureus]
MNIQEATKIATKNLVSMTRKDWKESHRTKILPTNDSFLQCIISNSDGTNLIRYWQPSADDLMANDWEVINPTRDQELLKQ
F
MNIQEATKIATKNLVSMTRKDWKESHRTKILPTNDSFLQCIISNSDGTNLIRYWQPSADDLMANDWEVINPTRDQELLKQ
F
Download Length: 246 bp
Antitoxin
Download Length: 366 bp
>AT265171 NZ_CP113016:c1902930-1902565 [Staphylococcus aureus]
ATGCCCTTGATATCTGATGAATTTGATACACTTACTAAAGACCAACAATATATCTTGTCCGTACTCTACAAAGATTATTT
AGAATGTGTAAAGTTAGGTTCGGTTAAATTAACCTGCAATAATTTTGGAAGTGCTAAAGATATACATACAAAGTATTTTC
AAAAACTACATTTCGAAGATGTAAAATACGATTTAAATAAACTTAAAAACTCTGGGTTCCTAAACGGCGTGTATGCTAGT
AACACTATTTATCATGTAACAATTTCAGACAAGACTGTTGTTTACTTTGAAAATGAGTTTAAAAACAATTTAAAAAGTAT
CATTGATAGCATTTCTAAAATTGCTTCAATAATTCCTGGTCTCTAG
ATGCCCTTGATATCTGATGAATTTGATACACTTACTAAAGACCAACAATATATCTTGTCCGTACTCTACAAAGATTATTT
AGAATGTGTAAAGTTAGGTTCGGTTAAATTAACCTGCAATAATTTTGGAAGTGCTAAAGATATACATACAAAGTATTTTC
AAAAACTACATTTCGAAGATGTAAAATACGATTTAAATAAACTTAAAAACTCTGGGTTCCTAAACGGCGTGTATGCTAGT
AACACTATTTATCATGTAACAATTTCAGACAAGACTGTTGTTTACTTTGAAAATGAGTTTAAAAACAATTTAAAAAGTAT
CATTGATAGCATTTCTAAAATTGCTTCAATAATTCCTGGTCTCTAG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|