Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 3021752..3022015 | Replicon | chromosome |
Accession | NZ_CP113015 | ||
Organism | Staphylococcus aureus strain Zed |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | OS078_RS15645 | Protein ID | WP_001802298.1 |
Coordinates | 3021911..3022015 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 3021752..3021916 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS078_RS15620 | 3017935..3018600 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
OS078_RS15625 | 3018752..3019072 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
OS078_RS15630 | 3019074..3020054 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
OS078_RS15635 | 3020320..3021411 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 3021752..3021916 | + | 165 | - | - | Antitoxin |
OS078_RS15645 | 3021911..3022015 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
OS078_RS15650 | 3022176..3022659 | - | 484 | Protein_3017 | recombinase family protein | - |
OS078_RS15655 | 3022702..3023838 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
OS078_RS15660 | 3024127..3024219 | + | 93 | WP_001790138.1 | hypothetical protein | - |
OS078_RS15665 | 3024508..3024692 | + | 185 | Protein_3020 | exotoxin | - |
OS078_RS15670 | 3024924..3025781 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
OS078_RS15675 | 3025849..3026631 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T265162 WP_001802298.1 NZ_CP113015:c3022015-3021911 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT265162 NZ_CP113015:3021752-3021916 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|