Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2773462..2773761 | Replicon | chromosome |
Accession | NZ_CP113015 | ||
Organism | Staphylococcus aureus strain Zed |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
Locus tag | OS078_RS14095 | Protein ID | WP_072482930.1 |
Coordinates | 2773585..2773761 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2773462..2773517 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS078_RS14055 | 2769020..2769199 | + | 180 | WP_000669789.1 | hypothetical protein | - |
OS078_RS14060 | 2769510..2769770 | + | 261 | WP_001791826.1 | hypothetical protein | - |
OS078_RS14065 | 2769823..2770173 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
OS078_RS14070 | 2770683..2771018 | - | 336 | Protein_2706 | SH3 domain-containing protein | - |
OS078_RS14075 | 2771670..2772161 | - | 492 | WP_000920041.1 | staphylokinase | - |
OS078_RS14080 | 2772352..2773107 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
OS078_RS14085 | 2773119..2773373 | - | 255 | WP_000611512.1 | phage holin | - |
OS078_RS14090 | 2773425..2773532 | + | 108 | Protein_2710 | hypothetical protein | - |
- | 2773454..2773593 | + | 140 | NuclAT_0 | - | - |
- | 2773454..2773593 | + | 140 | NuclAT_0 | - | - |
- | 2773454..2773593 | + | 140 | NuclAT_0 | - | - |
- | 2773454..2773593 | + | 140 | NuclAT_0 | - | - |
- | 2773462..2773517 | + | 56 | - | - | Antitoxin |
OS078_RS14095 | 2773585..2773761 | - | 177 | WP_072482930.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
OS078_RS14100 | 2773870..2774643 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
OS078_RS14105 | 2775016..2775390 | - | 375 | WP_000340977.1 | hypothetical protein | - |
OS078_RS14110 | 2775446..2775733 | - | 288 | WP_001262621.1 | hypothetical protein | - |
OS078_RS14115 | 2775779..2775931 | - | 153 | WP_001000059.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2769823..2827349 | 57526 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T265155 WP_072482930.1 NZ_CP113015:c2773761-2773585 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT265155 NZ_CP113015:2773462-2773517 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|