Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 2614765..2614947 Replicon chromosome
Accession NZ_CP113015
Organism Staphylococcus aureus strain Zed

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag OS078_RS13120 Protein ID WP_001801861.1
Coordinates 2614765..2614860 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 2614888..2614947 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS078_RS13080 2610425..2611051 + 627 WP_000669046.1 hypothetical protein -
OS078_RS13085 2611092..2611436 + 345 WP_000627551.1 DUF3969 family protein -
OS078_RS13090 2611534..2612085 + 552 WP_267793679.1 hypothetical protein -
OS078_RS13095 2612303..2612944 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
OS078_RS13100 2613058..2613243 - 186 WP_000809857.1 hypothetical protein -
OS078_RS13105 2613245..2613421 - 177 WP_000375476.1 hypothetical protein -
OS078_RS13110 2613432..2613815 - 384 WP_000070811.1 hypothetical protein -
OS078_RS13115 2614419..2614562 - 144 WP_001549059.1 transposase -
OS078_RS13120 2614765..2614860 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 2614888..2614947 - 60 - - Antitoxin
OS078_RS13125 2614983..2615084 + 102 WP_001791893.1 hypothetical protein -
OS078_RS13130 2615062..2615238 - 177 Protein_2558 transposase -
OS078_RS13135 2615432..2615809 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukD / hlgA 2588739..2646372 57633


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T265153 WP_001801861.1 NZ_CP113015:2614765-2614860 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT265153 NZ_CP113015:c2614947-2614888 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References