Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprG-sprF/-
Location 1979588..1979805 Replicon chromosome
Accession NZ_CP113009
Organism Staphylococcus aureus strain Orianna

Toxin (Protein)


Gene name SprG3 Uniprot ID Q2FWA7
Locus tag OS092_RS10310 Protein ID WP_001802298.1
Coordinates 1979701..1979805 (-) Length 35 a.a.

Antitoxin (RNA)


Gene name SprF4
Locus tag -
Coordinates 1979588..1979643 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS092_RS10285 1975725..1976390 - 666 WP_001024094.1 SDR family oxidoreductase -
OS092_RS10290 1976542..1976862 + 321 WP_000003759.1 Zn(II)-responsive metalloregulatory transcriptional repressor CzrA -
OS092_RS10295 1976864..1977844 + 981 WP_000019744.1 CDF family zinc efflux transporter CzrB -
OS092_RS10300 1978110..1979201 + 1092 WP_000495671.1 lytic regulatory protein -
- 1979588..1979643 + 56 - - Antitoxin
OS092_RS10310 1979701..1979805 - 105 WP_001802298.1 hypothetical protein Toxin
OS092_RS10315 1979966..1980449 - 484 Protein_1993 recombinase family protein -
OS092_RS10320 1980492..1981628 - 1137 WP_000115564.1 SAP domain-containing protein -
OS092_RS10325 1981917..1982009 + 93 WP_001790138.1 hypothetical protein -
OS092_RS10330 1982298..1982482 + 185 Protein_1996 exotoxin -
OS092_RS10335 1982714..1983571 - 858 WP_000370924.1 HAD family hydrolase -
OS092_RS10340 1983639..1984421 - 783 WP_000908176.1 ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 35 a.a.        Molecular weight: 3906.77 Da        Isoelectric Point: 5.5724

>T265143 WP_001802298.1 NZ_CP113009:c1979805-1979701 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK

Download         Length: 105 bp

Antitoxin


Download         Length: 56 bp

>AT265143 NZ_CP113009:1979588-1979643 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y9L9

Antitoxin

Download structure file

References