Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 1979588..1979805 | Replicon | chromosome |
| Accession | NZ_CP113009 | ||
| Organism | Staphylococcus aureus strain Orianna | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | OS092_RS10310 | Protein ID | WP_001802298.1 |
| Coordinates | 1979701..1979805 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 1979588..1979643 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS092_RS10285 | 1975725..1976390 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| OS092_RS10290 | 1976542..1976862 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| OS092_RS10295 | 1976864..1977844 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| OS092_RS10300 | 1978110..1979201 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 1979588..1979643 | + | 56 | - | - | Antitoxin |
| OS092_RS10310 | 1979701..1979805 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| OS092_RS10315 | 1979966..1980449 | - | 484 | Protein_1993 | recombinase family protein | - |
| OS092_RS10320 | 1980492..1981628 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| OS092_RS10325 | 1981917..1982009 | + | 93 | WP_001790138.1 | hypothetical protein | - |
| OS092_RS10330 | 1982298..1982482 | + | 185 | Protein_1996 | exotoxin | - |
| OS092_RS10335 | 1982714..1983571 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
| OS092_RS10340 | 1983639..1984421 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T265143 WP_001802298.1 NZ_CP113009:c1979805-1979701 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT265143 NZ_CP113009:1979588-1979643 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|