Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1409864..1410046 Replicon chromosome
Accession NZ_CP113007
Organism Staphylococcus aureus strain Ryze

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag OS082_RS07365 Protein ID WP_001801861.1
Coordinates 1409951..1410046 (-) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1409864..1409923 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS082_RS07350 1409002..1409379 + 378 WP_001037045.1 DUF1433 domain-containing protein -
OS082_RS07355 1409573..1409749 + 177 Protein_1414 transposase -
OS082_RS07360 1409727..1409828 - 102 WP_001791893.1 hypothetical protein -
- 1409864..1409923 + 60 - - Antitoxin
OS082_RS07365 1409951..1410046 - 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
OS082_RS07370 1410249..1410392 + 144 WP_001549059.1 transposase -
OS082_RS07375 1410996..1411379 + 384 WP_000070811.1 hypothetical protein -
OS082_RS07380 1411390..1411566 + 177 WP_000375476.1 hypothetical protein -
OS082_RS07385 1411568..1411753 + 186 WP_000809857.1 hypothetical protein -
OS082_RS07390 1411867..1412508 + 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
OS082_RS07395 1412726..1413277 - 552 WP_267793679.1 hypothetical protein -
OS082_RS07400 1413375..1413719 - 345 WP_000627551.1 DUF3969 family protein -
OS082_RS07405 1413760..1414386 - 627 WP_000669046.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1391692..1436071 44379


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T265127 WP_001801861.1 NZ_CP113007:c1410046-1409951 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT265127 NZ_CP113007:1409864-1409923 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References