Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1409864..1410046 | Replicon | chromosome |
| Accession | NZ_CP113007 | ||
| Organism | Staphylococcus aureus strain Ryze | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | OS082_RS07365 | Protein ID | WP_001801861.1 |
| Coordinates | 1409951..1410046 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1409864..1409923 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS082_RS07350 | 1409002..1409379 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| OS082_RS07355 | 1409573..1409749 | + | 177 | Protein_1414 | transposase | - |
| OS082_RS07360 | 1409727..1409828 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 1409864..1409923 | + | 60 | - | - | Antitoxin |
| OS082_RS07365 | 1409951..1410046 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| OS082_RS07370 | 1410249..1410392 | + | 144 | WP_001549059.1 | transposase | - |
| OS082_RS07375 | 1410996..1411379 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| OS082_RS07380 | 1411390..1411566 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| OS082_RS07385 | 1411568..1411753 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| OS082_RS07390 | 1411867..1412508 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| OS082_RS07395 | 1412726..1413277 | - | 552 | WP_267793679.1 | hypothetical protein | - |
| OS082_RS07400 | 1413375..1413719 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| OS082_RS07405 | 1413760..1414386 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1391692..1436071 | 44379 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T265127 WP_001801861.1 NZ_CP113007:c1410046-1409951 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT265127 NZ_CP113007:1409864-1409923 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|