Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) txpA-SprF3/-
Location 1251052..1251359 Replicon chromosome
Accession NZ_CP113007
Organism Staphylococcus aureus strain Ryze

Toxin (Protein)


Gene name txpA Uniprot ID A0A4U0AGH1
Locus tag OS082_RS06390 Protein ID WP_072482930.1
Coordinates 1251052..1251228 (+) Length 59 a.a.

Antitoxin (RNA)


Gene name SprF3
Locus tag -
Coordinates 1251220..1251359 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS082_RS06370 (1248882) 1248882..1249034 + 153 WP_001000059.1 hypothetical protein -
OS082_RS06375 (1249080) 1249080..1249367 + 288 WP_001262621.1 hypothetical protein -
OS082_RS06380 (1249423) 1249423..1249797 + 375 WP_000340977.1 hypothetical protein -
OS082_RS06385 (1250170) 1250170..1250943 + 774 WP_000750412.1 staphylococcal enterotoxin type A -
OS082_RS06390 (1251052) 1251052..1251228 + 177 WP_072482930.1 type I toxin-antitoxin system toxin PepG1 Toxin
- (1251220) 1251220..1251359 - 140 NuclAT_0 - Antitoxin
- (1251220) 1251220..1251359 - 140 NuclAT_0 - Antitoxin
- (1251220) 1251220..1251359 - 140 NuclAT_0 - Antitoxin
- (1251220) 1251220..1251359 - 140 NuclAT_0 - Antitoxin
OS082_RS06395 (1251281) 1251281..1251388 - 108 Protein_1262 hypothetical protein -
OS082_RS06400 (1251440) 1251440..1251694 + 255 WP_000611512.1 phage holin -
OS082_RS06405 (1251706) 1251706..1252461 + 756 WP_000861038.1 CHAP domain-containing protein -
OS082_RS06410 (1252652) 1252652..1253143 + 492 WP_000920041.1 staphylokinase -
OS082_RS06415 (1253793) 1253793..1254128 + 336 Protein_1266 SH3 domain-containing protein -
OS082_RS06420 (1254638) 1254638..1254988 + 351 WP_000702262.1 complement inhibitor SCIN-A -
OS082_RS06425 (1255041) 1255041..1255301 - 261 WP_001791826.1 hypothetical protein -
OS082_RS06430 (1255612) 1255612..1255791 - 180 WP_000669789.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - groEL / hlb / sea / sak / scn 1197465..1254988 57523


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Small toxic protein BsrE-like

(30-58)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6883.46 Da        Isoelectric Point: 10.6777

>T265125 WP_072482930.1 NZ_CP113007:1251052-1251228 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK

Download         Length: 177 bp

Antitoxin


Download         Length: 140 bp

>AT265125 NZ_CP113007:c1251359-1251220 [Staphylococcus aureus]
ATATATATAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4U0AGH1

Antitoxin

Download structure file

References