Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 1251052..1251390 | Replicon | chromosome |
Accession | NZ_CP113007 | ||
Organism | Staphylococcus aureus strain Ryze |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
Locus tag | OS082_RS06390 | Protein ID | WP_072482930.1 |
Coordinates | 1251052..1251228 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 1251216..1251390 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS082_RS06370 | 1248882..1249034 | + | 153 | WP_001000059.1 | hypothetical protein | - |
OS082_RS06375 | 1249080..1249367 | + | 288 | WP_001262621.1 | hypothetical protein | - |
OS082_RS06380 | 1249423..1249797 | + | 375 | WP_000340977.1 | hypothetical protein | - |
OS082_RS06385 | 1250170..1250943 | + | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
OS082_RS06390 | 1251052..1251228 | + | 177 | WP_072482930.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- | 1251216..1251390 | - | 175 | - | - | Antitoxin |
OS082_RS06400 | 1251440..1251694 | + | 255 | WP_000611512.1 | phage holin | - |
OS082_RS06405 | 1251706..1252461 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
OS082_RS06410 | 1252652..1253143 | + | 492 | WP_000920041.1 | staphylokinase | - |
OS082_RS06415 | 1253793..1254128 | + | 336 | Protein_1266 | SH3 domain-containing protein | - |
OS082_RS06420 | 1254638..1254988 | + | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
OS082_RS06425 | 1255041..1255301 | - | 261 | WP_001791826.1 | hypothetical protein | - |
OS082_RS06430 | 1255612..1255791 | - | 180 | WP_000669789.1 | hypothetical protein | - |
OS082_RS06435 | 1256163..1256360 | - | 198 | WP_000239610.1 | phospholipase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | groEL / hlb / sea / sak / scn | 1197465..1254988 | 57523 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T265123 WP_072482930.1 NZ_CP113007:1251052-1251228 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT265123 NZ_CP113007:c1251390-1251216 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATATAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATATAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|