Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 1004130..1004409 | Replicon | chromosome |
Accession | NZ_CP113007 | ||
Organism | Staphylococcus aureus strain Ryze |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | OS082_RS04855 | Protein ID | WP_001802298.1 |
Coordinates | 1004130..1004234 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1004230..1004409 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS082_RS04825 | 999514..1000296 | + | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
OS082_RS04830 | 1000364..1001221 | + | 858 | WP_000370924.1 | HAD family hydrolase | - |
OS082_RS04835 | 1001453..1001637 | - | 185 | Protein_955 | exotoxin | - |
OS082_RS04840 | 1001926..1002018 | - | 93 | WP_001790138.1 | hypothetical protein | - |
OS082_RS04845 | 1002307..1003443 | + | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
OS082_RS04850 | 1003486..1003969 | + | 484 | Protein_958 | recombinase family protein | - |
OS082_RS04855 | 1004130..1004234 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 1004230..1004409 | - | 180 | - | - | Antitoxin |
OS082_RS04865 | 1004734..1005825 | - | 1092 | WP_000495671.1 | lytic regulatory protein | - |
OS082_RS04870 | 1006091..1007071 | - | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
OS082_RS04875 | 1007073..1007393 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
OS082_RS04880 | 1007545..1008210 | + | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T265118 WP_001802298.1 NZ_CP113007:1004130-1004234 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT265118 NZ_CP113007:c1004409-1004230 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|