Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprG-sprF/-
Location 1808245..1808462 Replicon chromosome
Accession NZ_CP113005
Organism Staphylococcus aureus strain Galio

Toxin (Protein)


Gene name SprG3 Uniprot ID Q2FWA7
Locus tag OS073_RS09645 Protein ID WP_001802298.1
Coordinates 1808358..1808462 (-) Length 35 a.a.

Antitoxin (RNA)


Gene name SprF4
Locus tag -
Coordinates 1808245..1808300 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS073_RS09620 1804382..1805047 - 666 WP_001024094.1 SDR family oxidoreductase -
OS073_RS09625 1805199..1805519 + 321 WP_000003759.1 Zn(II)-responsive metalloregulatory transcriptional repressor CzrA -
OS073_RS09630 1805521..1806501 + 981 WP_000019744.1 CDF family zinc efflux transporter CzrB -
OS073_RS09635 1806767..1807858 + 1092 WP_000495671.1 lytic regulatory protein -
- 1808245..1808300 + 56 - - Antitoxin
OS073_RS09645 1808358..1808462 - 105 WP_001802298.1 hypothetical protein Toxin
OS073_RS09650 1808623..1809106 - 484 Protein_1815 recombinase family protein -
OS073_RS09655 1809149..1810285 - 1137 WP_000115564.1 SAP domain-containing protein -
OS073_RS09660 1810574..1810666 + 93 WP_001790138.1 hypothetical protein -
OS073_RS09665 1810955..1811139 + 185 Protein_1818 exotoxin -
OS073_RS09670 1811371..1812228 - 858 WP_000370924.1 HAD family hydrolase -
OS073_RS09675 1812296..1813078 - 783 WP_000908176.1 ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 35 a.a.        Molecular weight: 3906.77 Da        Isoelectric Point: 5.5724

>T265110 WP_001802298.1 NZ_CP113005:c1808462-1808358 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK

Download         Length: 105 bp

Antitoxin


Download         Length: 56 bp

>AT265110 NZ_CP113005:1808245-1808300 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y9L9

Antitoxin

Download structure file

References