Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 1808199..1808462 | Replicon | chromosome |
| Accession | NZ_CP113005 | ||
| Organism | Staphylococcus aureus strain Galio | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | OS073_RS09645 | Protein ID | WP_001802298.1 |
| Coordinates | 1808358..1808462 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 1808199..1808363 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS073_RS09620 | 1804382..1805047 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| OS073_RS09625 | 1805199..1805519 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| OS073_RS09630 | 1805521..1806501 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| OS073_RS09635 | 1806767..1807858 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 1808199..1808363 | + | 165 | - | - | Antitoxin |
| OS073_RS09645 | 1808358..1808462 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| OS073_RS09650 | 1808623..1809106 | - | 484 | Protein_1815 | recombinase family protein | - |
| OS073_RS09655 | 1809149..1810285 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| OS073_RS09660 | 1810574..1810666 | + | 93 | WP_001790138.1 | hypothetical protein | - |
| OS073_RS09665 | 1810955..1811139 | + | 185 | Protein_1818 | exotoxin | - |
| OS073_RS09670 | 1811371..1812228 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
| OS073_RS09675 | 1812296..1813078 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T265109 WP_001802298.1 NZ_CP113005:c1808462-1808358 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT265109 NZ_CP113005:1808199-1808363 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|