Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 1559996..1560295 | Replicon | chromosome |
| Accession | NZ_CP113005 | ||
| Organism | Staphylococcus aureus strain Galio | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
| Locus tag | OS073_RS08100 | Protein ID | WP_072482930.1 |
| Coordinates | 1560119..1560295 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 1559996..1560051 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS073_RS08060 | 1555554..1555733 | + | 180 | WP_000669789.1 | hypothetical protein | - |
| OS073_RS08065 | 1556044..1556304 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| OS073_RS08070 | 1556357..1556707 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| OS073_RS08075 | 1557217..1557552 | - | 336 | Protein_1505 | SH3 domain-containing protein | - |
| OS073_RS08080 | 1558204..1558695 | - | 492 | WP_000920041.1 | staphylokinase | - |
| OS073_RS08085 | 1558886..1559641 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| OS073_RS08090 | 1559653..1559907 | - | 255 | WP_000611512.1 | phage holin | - |
| OS073_RS08095 | 1559959..1560066 | + | 108 | Protein_1509 | hypothetical protein | - |
| - | 1559988..1560127 | + | 140 | NuclAT_0 | - | - |
| - | 1559988..1560127 | + | 140 | NuclAT_0 | - | - |
| - | 1559988..1560127 | + | 140 | NuclAT_0 | - | - |
| - | 1559988..1560127 | + | 140 | NuclAT_0 | - | - |
| - | 1559996..1560051 | + | 56 | - | - | Antitoxin |
| OS073_RS08100 | 1560119..1560295 | - | 177 | WP_072482930.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| OS073_RS08105 | 1560404..1561177 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| OS073_RS08110 | 1561550..1561924 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| OS073_RS08115 | 1561980..1562267 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| OS073_RS08120 | 1562313..1562465 | - | 153 | WP_001000059.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / sea / hlb / groEL | 1556357..1613883 | 57526 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T265102 WP_072482930.1 NZ_CP113005:c1560295-1560119 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT265102 NZ_CP113005:1559996-1560051 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|