Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3510768..3511438 | Replicon | chromosome |
Accession | NZ_CP112997 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 |
Toxin (Protein)
Gene name | higB | Uniprot ID | O53332 |
Locus tag | ORO20_RS16595 | Protein ID | WP_003899954.1 |
Coordinates | 3510768..3511112 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0THF6 |
Locus tag | ORO20_RS16600 | Protein ID | WP_003899955.1 |
Coordinates | 3511109..3511438 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO20_RS16560 (ORO20_16560) | 3505841..3506701 | + | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
ORO20_RS16565 (ORO20_16565) | 3506676..3507191 | + | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
ORO20_RS16570 (ORO20_16570) | 3507207..3507418 | + | 212 | Protein_3271 | (R)-hydratase | - |
ORO20_RS16575 (ORO20_16575) | 3507431..3507724 | + | 294 | WP_003416635.1 | hypothetical protein | - |
ORO20_RS16580 (ORO20_16580) | 3508012..3509301 | + | 1290 | WP_003416640.1 | ATP-binding protein | - |
ORO20_RS16585 (ORO20_16585) | 3509648..3510082 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
ORO20_RS16590 (ORO20_16590) | 3510085..3510537 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
ORO20_RS16595 (ORO20_16595) | 3510768..3511112 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ORO20_RS16600 (ORO20_16600) | 3511109..3511438 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
ORO20_RS16605 (ORO20_16605) | 3511976..3512323 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
ORO20_RS16610 (ORO20_16610) | 3512320..3512940 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
ORO20_RS16615 (ORO20_16615) | 3513100..3514365 | - | 1266 | WP_003909837.1 | hypothetical protein | - |
ORO20_RS16620 (ORO20_16620) | 3514533..3514742 | + | 210 | WP_003416778.1 | hypothetical protein | - |
ORO20_RS16625 (ORO20_16625) | 3514989..3516023 | - | 1035 | WP_003416786.1 | IS30 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T265093 WP_003899954.1 NZ_CP112997:3510768-3511112 [Mycobacterium tuberculosis variant bovis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Download Length: 110 a.a. Molecular weight: 11802.46 Da Isoelectric Point: 7.4051
>AT265093 WP_003899955.1 NZ_CP112997:3511109-3511438 [Mycobacterium tuberculosis variant bovis]
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
Download Length: 330 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBK2 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6LTY | |
PDB | 6LTZ | |
AlphaFold DB | G0THF6 |