Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
| Location | 2196186..2197054 | Replicon | chromosome |
| Accession | NZ_CP112997 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain 2016/0386 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | P9WJA4 |
| Locus tag | ORO20_RS10245 | Protein ID | WP_010886136.1 |
| Coordinates | 2196186..2196563 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0TLM0 |
| Locus tag | ORO20_RS10250 | Protein ID | WP_003409886.1 |
| Coordinates | 2196605..2197054 (+) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORO20_RS10195 (ORO20_10195) | 2191975..2192427 | - | 453 | WP_010950636.1 | lipoprotein | - |
| ORO20_RS10200 (ORO20_10200) | 2192491..2192892 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| ORO20_RS10205 (ORO20_10205) | 2192885..2193067 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| ORO20_RS10210 (ORO20_10210) | 2193181..2193531 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| ORO20_RS10215 (ORO20_10215) | 2193542..2194444 | - | 903 | WP_003409874.1 | hypothetical protein | - |
| ORO20_RS10220 (ORO20_10220) | 2194465..2194656 | - | 192 | WP_003409876.1 | hypothetical protein | - |
| ORO20_RS10225 (ORO20_10225) | 2194657..2194953 | - | 297 | WP_003409877.1 | hypothetical protein | - |
| ORO20_RS10230 (ORO20_10230) | 2195193..2195408 | + | 216 | WP_003409878.1 | antitoxin | - |
| ORO20_RS10235 (ORO20_10235) | 2195405..2195716 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
| ORO20_RS10240 (ORO20_10240) | 2195690..2196211 | - | 522 | WP_010950637.1 | hypothetical protein | - |
| ORO20_RS10245 (ORO20_10245) | 2196186..2196563 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| ORO20_RS10250 (ORO20_10250) | 2196605..2197054 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| ORO20_RS10255 (ORO20_10255) | 2197051..2197596 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
| ORO20_RS10260 (ORO20_10260) | 2197485..2198099 | - | 615 | WP_003901296.1 | hypothetical protein | - |
| ORO20_RS10265 (ORO20_10265) | 2198148..2198444 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| ORO20_RS10270 (ORO20_10270) | 2198441..2198692 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| ORO20_RS10275 (ORO20_10275) | 2198679..2199173 | + | 495 | WP_003899099.1 | hypothetical protein | - |
| ORO20_RS10280 (ORO20_10280) | 2199333..2199740 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
| ORO20_RS10285 (ORO20_10285) | 2199744..2200016 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| ORO20_RS10290 (ORO20_10290) | 2200049..2201269 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T265070 WP_010886136.1 NZ_CP112997:2196186-2196563 [Mycobacterium tuberculosis variant bovis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT265070 WP_003409886.1 NZ_CP112997:2196605-2197054 [Mycobacterium tuberculosis variant bovis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|