Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 300535..301048 | Replicon | chromosome |
Accession | NZ_CP112971 | ||
Organism | Rickettsia conorii subsp. heilongjiangensis strain B8 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | H6QL72 |
Locus tag | OSR38_RS01530 | Protein ID | WP_012152537.1 |
Coordinates | 300788..301048 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | A0A0F3RGJ3 |
Locus tag | OSR38_RS01525 | Protein ID | WP_014013992.1 |
Coordinates | 300535..300777 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSR38_RS01505 (OSR38_01505) | 295562..297331 | - | 1770 | WP_014013988.1 | ABC transporter ATP-binding protein | - |
OSR38_RS01510 (OSR38_01510) | 297512..297781 | + | 270 | WP_014013989.1 | DUF2671 domain-containing protein | - |
OSR38_RS01515 (OSR38_01515) | 297936..299306 | + | 1371 | WP_267185272.1 | cytochrome ubiquinol oxidase subunit I | - |
OSR38_RS01520 (OSR38_01520) | 299314..300333 | + | 1020 | WP_014013991.1 | cytochrome d ubiquinol oxidase subunit II | - |
OSR38_RS01525 (OSR38_01525) | 300535..300777 | + | 243 | WP_014013992.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OSR38_RS01530 (OSR38_01530) | 300788..301048 | + | 261 | WP_012152537.1 | Txe/YoeB family addiction module toxin | Toxin |
OSR38_RS01535 (OSR38_01535) | 301041..301889 | + | 849 | WP_267185273.1 | glycosyltransferase family 2 protein | - |
OSR38_RS01540 (OSR38_01540) | 301966..303204 | + | 1239 | WP_267185274.1 | pitrilysin family protein | - |
OSR38_RS01545 (OSR38_01545) | 303358..304068 | + | 711 | WP_004996420.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
OSR38_RS01550 (OSR38_01550) | 304297..305883 | + | 1587 | WP_267185275.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10314.10 Da Isoelectric Point: 9.9572
>T264965 WP_012152537.1 NZ_CP112971:300788-301048 [Rickettsia conorii subsp. heilongjiangensis]
MYIIRYTTQAQKDAKKIVQAGLKNKVEVLLNIVSTDPWKIYPPYEKLVGDFSGCYSRRINIQHRLVYEVYKQEKVVKILR
MYTHYE
MYIIRYTTQAQKDAKKIVQAGLKNKVEVLLNIVSTDPWKIYPPYEKLVGDFSGCYSRRINIQHRLVYEVYKQEKVVKILR
MYTHYE
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | H6QL72 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F3RGJ3 |