Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1018887..1019537 | Replicon | chromosome |
Accession | NZ_CP112887 | ||
Organism | Raoultella electrica strain S2-IND-01-C |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OR613_RS04875 | Protein ID | WP_131048716.1 |
Coordinates | 1019196..1019537 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OR613_RS04870 | Protein ID | WP_131048715.1 |
Coordinates | 1018887..1019186 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OR613_RS04860 (OR613_04855) | 1015302..1016036 | + | 735 | WP_131048714.1 | phosphoadenosine phosphosulfate reductase | - |
OR613_RS04865 (OR613_04860) | 1016087..1018792 | - | 2706 | WP_271207638.1 | CRISPR-associated helicase Cas3' | - |
OR613_RS04870 (OR613_04865) | 1018887..1019186 | - | 300 | WP_131048715.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OR613_RS04875 (OR613_04870) | 1019196..1019537 | - | 342 | WP_131048716.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OR613_RS04880 (OR613_04875) | 1019892..1021427 | + | 1536 | WP_131048717.1 | type I-E CRISPR-associated protein Cse1/CasA | - |
OR613_RS04885 (OR613_04880) | 1021405..1022046 | + | 642 | WP_242627885.1 | type I-E CRISPR-associated protein Cse2/CasB | - |
OR613_RS04890 (OR613_04885) | 1022069..1023127 | + | 1059 | WP_131048718.1 | type I-E CRISPR-associated protein Cas7/Cse4/CasC | - |
OR613_RS04895 (OR613_04890) | 1023137..1023862 | + | 726 | WP_131048719.1 | type I-E CRISPR-associated protein Cas5/CasD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13000.60 Da Isoelectric Point: 4.6998
>T264942 WP_131048716.1 NZ_CP112887:c1019537-1019196 [Raoultella electrica]
MWDIETTDAFDEWFEAQTGALQEDMLAAMVILSEYGPQLGRPFADTVNDSAFPNMKELRVQHQGNPIRAFFAFDPSRHGI
VLCAGDKTGLSEKRFYRDMLRLADNEYRNHLNK
MWDIETTDAFDEWFEAQTGALQEDMLAAMVILSEYGPQLGRPFADTVNDSAFPNMKELRVQHQGNPIRAFFAFDPSRHGI
VLCAGDKTGLSEKRFYRDMLRLADNEYRNHLNK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|