Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
| Location | 4823551..4824059 | Replicon | chromosome |
| Accession | NZ_CP112880 | ||
| Organism | Streptomyces sp. CA-278952 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | N7925_RS21705 | Protein ID | WP_274344875.1 |
| Coordinates | 4823551..4823811 (-) | Length | 87 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | A0A1C4HSG8 |
| Locus tag | N7925_RS21710 | Protein ID | WP_050358889.1 |
| Coordinates | 4823808..4824059 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7925_RS21680 (N7925_21690) | 4818789..4819163 | + | 375 | WP_274344871.1 | hypothetical protein | - |
| N7925_RS21685 (N7925_21695) | 4819330..4820205 | + | 876 | WP_274344872.1 | TatD family hydrolase | - |
| N7925_RS21690 (N7925_21700) | 4820318..4821190 | + | 873 | WP_265601138.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| N7925_RS21695 (N7925_21705) | 4821187..4822125 | + | 939 | WP_274344873.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| N7925_RS21700 (N7925_21710) | 4822207..4823541 | + | 1335 | WP_274344874.1 | acyltransferase | - |
| N7925_RS21705 (N7925_21715) | 4823551..4823811 | - | 261 | WP_274344875.1 | Txe/YoeB family addiction module toxin | Toxin |
| N7925_RS21710 (N7925_21720) | 4823808..4824059 | - | 252 | WP_050358889.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| N7925_RS21715 (N7925_21725) | 4824166..4825239 | - | 1074 | WP_274344876.1 | hypothetical protein | - |
| N7925_RS21720 (N7925_21730) | 4825236..4826369 | - | 1134 | WP_274344877.1 | hypothetical protein | - |
| N7925_RS21725 (N7925_21735) | 4826452..4827207 | - | 756 | WP_274344878.1 | lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10353.66 Da Isoelectric Point: 9.4413
>T264936 WP_274344875.1 NZ_CP112880:c4823811-4823551 [Streptomyces sp. CA-278952]
VKFVWDQSSWDDYVWWQNQDRKILKRINTLLQDIARNGNEGMGKPEPLKHGFQGYWSRRITDEHRLIYTVAGDEVRIAAC
RYHYGR
VKFVWDQSSWDDYVWWQNQDRKILKRINTLLQDIARNGNEGMGKPEPLKHGFQGYWSRRITDEHRLIYTVAGDEVRIAAC
RYHYGR
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|