Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 1827022..1827626 | Replicon | chromosome |
Accession | NZ_CP112868 | ||
Organism | Pseudomonas quebecensis isolate S1Bt3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OSC49_RS08325 | Protein ID | WP_266248415.1 |
Coordinates | 1827312..1827626 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OSC49_RS08320 | Protein ID | WP_181081085.1 |
Coordinates | 1827022..1827309 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSC49_RS08305 (OSC49_08305) | 1823693..1825192 | + | 1500 | WP_266249693.1 | IS21 family transposase | - |
OSC49_RS08310 (OSC49_08310) | 1825185..1825988 | + | 804 | WP_266248411.1 | IS21-like element helper ATPase IstB | - |
OSC49_RS08315 (OSC49_08315) | 1826422..1826859 | + | 438 | WP_266248413.1 | hypothetical protein | - |
OSC49_RS08320 (OSC49_08320) | 1827022..1827309 | - | 288 | WP_181081085.1 | NadS family protein | Antitoxin |
OSC49_RS08325 (OSC49_08325) | 1827312..1827626 | - | 315 | WP_266248415.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OSC49_RS08330 (OSC49_08330) | 1827976..1828113 | + | 138 | Protein_1640 | HNH endonuclease | - |
OSC49_RS08335 (OSC49_08335) | 1828207..1828707 | + | 501 | WP_266248417.1 | hypothetical protein | - |
OSC49_RS08340 (OSC49_08340) | 1828811..1830307 | - | 1497 | WP_266248419.1 | hypothetical protein | - |
OSC49_RS08345 (OSC49_08345) | 1830356..1832275 | - | 1920 | WP_181081080.1 | response regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1819115..1827626 | 8511 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11816.69 Da Isoelectric Point: 10.2638
>T264896 WP_266248415.1 NZ_CP112868:c1827626-1827312 [Pseudomonas quebecensis]
MIFIETPTFTRRVKELIDDDAYTVFQRALMLNPSAGDVIEGTGGIRKARIAAKGHGKQGGARVIYYHFVSMSQIIRLMIY
PKNEQHALTSDERKALKAAIEHWR
MIFIETPTFTRRVKELIDDDAYTVFQRALMLNPSAGDVIEGTGGIRKARIAAKGHGKQGGARVIYYHFVSMSQIIRLMIY
PKNEQHALTSDERKALKAAIEHWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|