Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 2424443..2425097 | Replicon | chromosome |
Accession | NZ_CP111114 | ||
Organism | Pseudomonas koreensis strain FP1691 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A854X939 |
Locus tag | OPS05_RS10690 | Protein ID | WP_027614658.1 |
Coordinates | 2424747..2425097 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OPS05_RS10685 | Protein ID | WP_027614657.1 |
Coordinates | 2424443..2424757 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OPS05_RS10665 (OPS05_10665) | 2420862..2421062 | + | 201 | WP_134785998.1 | co-regulatory protein PtrA N-terminal domain-containing protein | - |
OPS05_RS10670 (OPS05_10670) | 2421129..2421461 | + | 333 | WP_134785999.1 | DUF2790 domain-containing protein | - |
OPS05_RS10675 (OPS05_10675) | 2421580..2422764 | - | 1185 | WP_134786000.1 | acyltransferase | - |
OPS05_RS10680 (OPS05_10680) | 2422944..2424269 | - | 1326 | WP_134786001.1 | OprD family porin | - |
OPS05_RS10685 (OPS05_10685) | 2424443..2424757 | - | 315 | WP_027614657.1 | transcriptional regulator | Antitoxin |
OPS05_RS10690 (OPS05_10690) | 2424747..2425097 | - | 351 | WP_027614658.1 | toxin | Toxin |
OPS05_RS10695 (OPS05_10695) | 2425467..2425931 | + | 465 | WP_098968147.1 | GNAT family N-acetyltransferase | - |
OPS05_RS10700 (OPS05_10700) | 2426123..2427586 | - | 1464 | WP_003223784.1 | NADH-quinone oxidoreductase subunit NuoN | - |
OPS05_RS10705 (OPS05_10705) | 2427594..2429126 | - | 1533 | WP_003223785.1 | NADH-quinone oxidoreductase subunit M | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13966.76 Da Isoelectric Point: 7.2031
>T264854 WP_027614658.1 NZ_CP111114:c2425097-2424747 [Pseudomonas koreensis]
MDALFIELPVFQKHRDDYLDDDLFRSFQLELLKNPEAGDLIEDTGGLRKIRFSDQRRGKGKRSGLRVIYYWWSGFDQFWL
FTVFNKNEQDDLTPAQKKLFRKTLDRELNARSHYET
MDALFIELPVFQKHRDDYLDDDLFRSFQLELLKNPEAGDLIEDTGGLRKIRFSDQRRGKGKRSGLRVIYYWWSGFDQFWL
FTVFNKNEQDDLTPAQKKLFRKTLDRELNARSHYET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|