Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 319457..320061 | Replicon | chromosome |
Accession | NZ_CP111114 | ||
Organism | Pseudomonas koreensis strain FP1691 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q3KJP2 |
Locus tag | OPS05_RS01380 | Protein ID | WP_011331970.1 |
Coordinates | 319747..320061 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OPS05_RS01375 | Protein ID | WP_098966690.1 |
Coordinates | 319457..319744 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OPS05_RS01350 (OPS05_01350) | 314587..315006 | - | 420 | WP_232324076.1 | ATP-dependent zinc protease | - |
OPS05_RS01355 (OPS05_01355) | 315283..315690 | + | 408 | WP_098966686.1 | RNA-binding S4 domain-containing protein | - |
OPS05_RS01360 (OPS05_01360) | 315857..316660 | - | 804 | WP_096796730.1 | phosphatase PAP2 family protein | - |
OPS05_RS01365 (OPS05_01365) | 316766..317668 | + | 903 | WP_098966688.1 | Hsp33 family molecular chaperone HslO | - |
OPS05_RS01370 (OPS05_01370) | 317850..319391 | + | 1542 | WP_027611209.1 | phosphoenolpyruvate carboxykinase | - |
OPS05_RS01375 (OPS05_01375) | 319457..319744 | - | 288 | WP_098966690.1 | NadS family protein | Antitoxin |
OPS05_RS01380 (OPS05_01380) | 319747..320061 | - | 315 | WP_011331970.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OPS05_RS01385 (OPS05_01385) | 320173..320472 | - | 300 | WP_134785191.1 | hypothetical protein | - |
OPS05_RS01390 (OPS05_01390) | 320820..321962 | - | 1143 | WP_134785192.1 | hypothetical protein | - |
OPS05_RS01395 (OPS05_01395) | 322055..322330 | - | 276 | WP_098966695.1 | hypothetical protein | - |
OPS05_RS01400 (OPS05_01400) | 322633..323136 | + | 504 | WP_134785193.1 | polysaccharide deacetylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11847.76 Da Isoelectric Point: 10.3534
>T264851 WP_011331970.1 NZ_CP111114:c320061-319747 [Pseudomonas koreensis]
MIFIETRIFTRRVKELLDDDTYAAFQKQLVVSPSIGDVIEGTGGIRKTRIAAKGHGKRGGARVIYYHFVSASQIGLLMIY
PKNEQHDLSSDERKALKVLIEKWR
MIFIETRIFTRRVKELLDDDTYAAFQKQLVVSPSIGDVIEGTGGIRKTRIAAKGHGKRGGARVIYYHFVSASQIGLLMIY
PKNEQHDLSSDERKALKVLIEKWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|