Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5367167..5367762 | Replicon | chromosome |
Accession | NZ_CP111034 | ||
Organism | Pseudomonas aeruginosa strain PALA50 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PALA50_RS24895 | Protein ID | WP_003113526.1 |
Coordinates | 5367484..5367762 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA50_RS24890 | Protein ID | WP_003113527.1 |
Coordinates | 5367167..5367472 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA50_RS24855 (PALA50_04937) | 5362449..5362721 | - | 273 | WP_004352675.1 | hypothetical protein | - |
PALA50_RS24860 (PALA50_04938) | 5362831..5363097 | + | 267 | WP_023088595.1 | hypothetical protein | - |
PALA50_RS24865 | 5363153..5363488 | + | 336 | WP_043086918.1 | hypothetical protein | - |
PALA50_RS24870 (PALA50_04939) | 5363550..5364227 | - | 678 | WP_182375736.1 | hypothetical protein | - |
PALA50_RS24875 (PALA50_04940) | 5364224..5365108 | - | 885 | WP_073652264.1 | DNA-processing protein DprA | - |
PALA50_RS24880 (PALA50_04941) | 5365213..5366169 | - | 957 | WP_073652263.1 | hypothetical protein | - |
PALA50_RS24885 | 5366417..5366830 | - | 414 | WP_073652262.1 | hypothetical protein | - |
PALA50_RS24890 (PALA50_04942) | 5367167..5367472 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
PALA50_RS24895 | 5367484..5367762 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA50_RS24900 | 5367815..5367943 | - | 129 | Protein_4918 | integrase | - |
PALA50_RS24905 (PALA50_04943) | 5368091..5370319 | + | 2229 | WP_023086667.1 | TonB-dependent receptor | - |
PALA50_RS24910 (PALA50_04944) | 5370389..5371036 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA50_RS24915 (PALA50_04945) | 5371098..5372336 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T264835 WP_003113526.1 NZ_CP111034:c5367762-5367484 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|