Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5731795..5732390 | Replicon | chromosome |
Accession | NZ_CP111032 | ||
Organism | Pseudomonas aeruginosa strain PALA54 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PALA54_RS26870 | Protein ID | WP_003113526.1 |
Coordinates | 5732112..5732390 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA54_RS26865 | Protein ID | WP_003133769.1 |
Coordinates | 5731795..5732100 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA54_RS26830 | 5727361..5727651 | - | 291 | WP_023083237.1 | DUF5447 family protein | - |
PALA54_RS26835 (PALA54_05311) | 5727827..5728099 | - | 273 | WP_004352675.1 | hypothetical protein | - |
PALA54_RS26840 | 5728212..5728484 | + | 273 | WP_034021304.1 | hypothetical protein | - |
PALA54_RS26845 | 5728540..5728875 | + | 336 | WP_025921265.1 | hypothetical protein | - |
PALA54_RS26850 (PALA54_05313) | 5729036..5730412 | + | 1377 | WP_071534372.1 | DUF3696 domain-containing protein | - |
PALA54_RS26855 | 5730409..5730891 | + | 483 | WP_071534371.1 | hypothetical protein | - |
PALA54_RS26860 (PALA54_05314) | 5731052..5731459 | - | 408 | WP_052151012.1 | hypothetical protein | - |
PALA54_RS26865 (PALA54_05315) | 5731795..5732100 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
PALA54_RS26870 | 5732112..5732390 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA54_RS26875 | 5732443..5732571 | - | 129 | Protein_5314 | integrase | - |
PALA54_RS26880 (PALA54_05316) | 5732719..5734947 | + | 2229 | WP_043088355.1 | TonB-dependent receptor | - |
PALA54_RS26885 (PALA54_05317) | 5735018..5735665 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA54_RS26890 (PALA54_05318) | 5735727..5736965 | - | 1239 | WP_043085810.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T264829 WP_003113526.1 NZ_CP111032:c5732390-5732112 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|