Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 5016742..5017423 | Replicon | chromosome |
Accession | NZ_CP111032 | ||
Organism | Pseudomonas aeruginosa strain PALA54 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PALA54_RS23475 | Protein ID | WP_015503432.1 |
Coordinates | 5017058..5017423 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA54_RS23470 | Protein ID | WP_004364117.1 |
Coordinates | 5016742..5017065 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA54_RS23440 (PALA54_04643) | 5012662..5012820 | + | 159 | WP_171945474.1 | hypothetical protein | - |
PALA54_RS23445 (PALA54_04644) | 5012904..5013299 | + | 396 | WP_171945473.1 | hypothetical protein | - |
PALA54_RS23450 (PALA54_04645) | 5013542..5013877 | + | 336 | WP_003140884.1 | TM2 domain-containing protein | - |
PALA54_RS23455 (PALA54_04646) | 5014051..5014569 | + | 519 | WP_003140886.1 | PAAR domain-containing protein | - |
PALA54_RS23460 (PALA54_04647) | 5014566..5015267 | + | 702 | WP_003111822.1 | VRR-NUC domain-containing protein | - |
PALA54_RS23465 (PALA54_04648) | 5015284..5016372 | + | 1089 | WP_043086021.1 | DUF3396 domain-containing protein | - |
PALA54_RS23470 (PALA54_04649) | 5016742..5017065 | - | 324 | WP_004364117.1 | XRE family transcriptional regulator | Antitoxin |
PALA54_RS23475 | 5017058..5017423 | - | 366 | WP_015503432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA54_RS23480 | 5017716..5017955 | - | 240 | WP_044060930.1 | hypothetical protein | - |
PALA54_RS23485 (PALA54_04650) | 5018162..5018434 | + | 273 | WP_009315277.1 | hypothetical protein | - |
PALA54_RS23490 (PALA54_04651) | 5018465..5018890 | - | 426 | WP_033991429.1 | VOC family protein | - |
PALA54_RS23495 (PALA54_04652) | 5018990..5019874 | + | 885 | WP_003140892.1 | LysR substrate-binding domain-containing protein | - |
PALA54_RS23500 (PALA54_04653) | 5019847..5020800 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
PALA54_RS23505 (PALA54_04654) | 5021021..5021455 | + | 435 | WP_003158601.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 5013542..5037222 | 23680 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13798.14 Da Isoelectric Point: 4.8219
>T264827 WP_015503432.1 NZ_CP111032:c5017423-5017058 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|