Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5688621..5689216 | Replicon | chromosome |
| Accession | NZ_CP111030 | ||
| Organism | Pseudomonas aeruginosa strain PALA38 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | PALA38_RS26625 | Protein ID | WP_003113526.1 |
| Coordinates | 5688938..5689216 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA38_RS26620 | Protein ID | WP_003133769.1 |
| Coordinates | 5688621..5688926 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA38_RS26585 | 5684187..5684477 | - | 291 | WP_023083237.1 | DUF5447 family protein | - |
| PALA38_RS26590 (PALA38_05254) | 5684653..5684925 | - | 273 | WP_004352675.1 | hypothetical protein | - |
| PALA38_RS26595 | 5685038..5685310 | + | 273 | WP_034021304.1 | hypothetical protein | - |
| PALA38_RS26600 | 5685366..5685701 | + | 336 | WP_025921265.1 | hypothetical protein | - |
| PALA38_RS26605 (PALA38_05256) | 5685862..5687238 | + | 1377 | WP_071534372.1 | DUF3696 domain-containing protein | - |
| PALA38_RS26610 | 5687235..5687717 | + | 483 | WP_071534371.1 | hypothetical protein | - |
| PALA38_RS26615 (PALA38_05257) | 5687878..5688285 | - | 408 | WP_052151012.1 | hypothetical protein | - |
| PALA38_RS26620 (PALA38_05258) | 5688621..5688926 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA38_RS26625 | 5688938..5689216 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA38_RS26630 | 5689269..5689397 | - | 129 | Protein_5265 | integrase | - |
| PALA38_RS26635 (PALA38_05259) | 5689545..5691773 | + | 2229 | WP_043088355.1 | TonB-dependent receptor | - |
| PALA38_RS26640 (PALA38_05260) | 5691844..5692491 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA38_RS26645 (PALA38_05261) | 5692553..5693791 | - | 1239 | WP_043085810.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T264821 WP_003113526.1 NZ_CP111030:c5689216-5688938 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|