Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4974683..4975364 | Replicon | chromosome |
Accession | NZ_CP111030 | ||
Organism | Pseudomonas aeruginosa strain PALA38 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PALA38_RS23240 | Protein ID | WP_015503432.1 |
Coordinates | 4974999..4975364 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA38_RS23235 | Protein ID | WP_004364117.1 |
Coordinates | 4974683..4975006 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA38_RS23205 (PALA38_04589) | 4970603..4970761 | + | 159 | WP_171945474.1 | hypothetical protein | - |
PALA38_RS23210 (PALA38_04590) | 4970845..4971240 | + | 396 | WP_171945473.1 | hypothetical protein | - |
PALA38_RS23215 (PALA38_04591) | 4971483..4971818 | + | 336 | WP_003140884.1 | TM2 domain-containing protein | - |
PALA38_RS23220 (PALA38_04592) | 4971992..4972510 | + | 519 | WP_003140886.1 | PAAR domain-containing protein | - |
PALA38_RS23225 (PALA38_04593) | 4972507..4973208 | + | 702 | WP_003111822.1 | VRR-NUC domain-containing protein | - |
PALA38_RS23230 (PALA38_04594) | 4973225..4974313 | + | 1089 | WP_043086021.1 | DUF3396 domain-containing protein | - |
PALA38_RS23235 (PALA38_04595) | 4974683..4975006 | - | 324 | WP_004364117.1 | XRE family transcriptional regulator | Antitoxin |
PALA38_RS23240 | 4974999..4975364 | - | 366 | WP_015503432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA38_RS23245 | 4975657..4975896 | - | 240 | WP_044060930.1 | hypothetical protein | - |
PALA38_RS23250 (PALA38_04596) | 4976103..4976375 | + | 273 | WP_009315277.1 | hypothetical protein | - |
PALA38_RS23255 (PALA38_04597) | 4976406..4976831 | - | 426 | WP_033991429.1 | VOC family protein | - |
PALA38_RS23260 (PALA38_04598) | 4976931..4977815 | + | 885 | WP_003140892.1 | LysR substrate-binding domain-containing protein | - |
PALA38_RS23265 (PALA38_04599) | 4977788..4978741 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
PALA38_RS23270 (PALA38_04600) | 4978962..4979396 | + | 435 | WP_003158601.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4971483..4977815 | 6332 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13798.14 Da Isoelectric Point: 4.8219
>T264819 WP_015503432.1 NZ_CP111030:c4975364-4974999 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|