Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4405831..4406585 | Replicon | chromosome |
| Accession | NZ_CP111029 | ||
| Organism | Salmonella sp. 2018103 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | OLG56_RS21185 | Protein ID | WP_000558166.1 |
| Coordinates | 4405831..4406142 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OLG56_RS21190 | Protein ID | WP_001259009.1 |
| Coordinates | 4406139..4406585 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLG56_RS21155 (4401489) | 4401489..4402391 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| OLG56_RS21160 (4402388) | 4402388..4403023 | + | 636 | WP_023205206.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OLG56_RS21165 (4403020) | 4403020..4403949 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| OLG56_RS21170 (4403996) | 4403996..4404286 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| OLG56_RS21175 (4404287) | 4404287..4404598 | - | 312 | WP_023205205.1 | hypothetical protein | - |
| OLG56_RS21180 (4404816) | 4404816..4405745 | + | 930 | WP_001631559.1 | alpha/beta hydrolase | - |
| OLG56_RS21185 (4405831) | 4405831..4406142 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OLG56_RS21190 (4406139) | 4406139..4406585 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| OLG56_RS21195 (4406600) | 4406600..4407541 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| OLG56_RS21200 (4407586) | 4407586..4408023 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| OLG56_RS21205 (4408020) | 4408020..4408892 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| OLG56_RS21210 (4408886) | 4408886..4409485 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| OLG56_RS21215 (4409676) | 4409676..4410479 | - | 804 | WP_023137059.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| OLG56_RS21220 (4410513) | 4410513..4411409 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T264813 WP_000558166.1 NZ_CP111029:4405831-4406142 [Salmonella sp. 2018103]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT264813 WP_001259009.1 NZ_CP111029:4406139-4406585 [Salmonella sp. 2018103]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|