Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symER/SymE(toxin) |
| Location | 3840702..3841114 | Replicon | chromosome |
| Accession | NZ_CP111008 | ||
| Organism | Escherichia coli strain J53-p130 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | U9YSY7 |
| Locus tag | ORI87_RS18865 | Protein ID | WP_000132601.1 |
| Coordinates | 3840773..3841114 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | symR | ||
| Locus tag | - | ||
| Coordinates | 3840702..3840778 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI87_RS18855 (3837565) | 3837565..3839154 | + | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
| ORI87_RS18860 (3839151) | 3839151..3840545 | + | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
| - (3840702) | 3840702..3840778 | - | 77 | NuclAT_14 | - | Antitoxin |
| - (3840702) | 3840702..3840778 | - | 77 | NuclAT_14 | - | Antitoxin |
| - (3840702) | 3840702..3840778 | - | 77 | NuclAT_14 | - | Antitoxin |
| - (3840702) | 3840702..3840778 | - | 77 | NuclAT_14 | - | Antitoxin |
| - (3840702) | 3840702..3840778 | - | 77 | NuclAT_15 | - | Antitoxin |
| - (3840702) | 3840702..3840778 | - | 77 | NuclAT_15 | - | Antitoxin |
| - (3840702) | 3840702..3840778 | - | 77 | NuclAT_15 | - | Antitoxin |
| - (3840702) | 3840702..3840778 | - | 77 | NuclAT_15 | - | Antitoxin |
| ORI87_RS18865 (3840773) | 3840773..3841114 | + | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
| ORI87_RS18870 (3841276) | 3841276..3842655 | + | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
| ORI87_RS18875 (3842655) | 3842655..3843701 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T264790 WP_000132601.1 NZ_CP111008:3840773-3841114 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT264790 NZ_CP111008:c3840778-3840702 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|